Recombinant Human PRKRIR GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human PRKRIR GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-150 of Human PRKRIR full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
PRKRIR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
42.24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PRKRIR GST (N-Term) Protein

  • 58 kDa interferon-induced protein kinase-interacting protein
  • DAP452 kDa repressor of the inhibitor of the protein kinase
  • Death-associated protein 4
  • inhibitor of protein kinase PKR
  • MGC102750
  • P52rIPK
  • p58IPK-interacting protein
  • protein-kinase, interferon-inducible double stranded RNA dependent inhibitor
  • repressor of (P58 repressor)
  • THAP domain-containing protein 0
  • THAP0

Background

PRKRIR( AAH21992, 1 a.a. - 151 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-48704
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00006789-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
NBP1-77266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
MAB3468
Species: Hu
Applications: ICC, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP1-87132
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-33860
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-48308
Species: Bv, Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
NB100-79802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-82617
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-74340
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-89699
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
352-MS/CF
Species: Hu
Applications: BA, BA
NBP2-92044
Species: Hu, Mu
Applications: WB

Publications for PRKRIR Recombinant Protein (H00005612-P01) (0)

There are no publications for PRKRIR Recombinant Protein (H00005612-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRKRIR Recombinant Protein (H00005612-P01) (0)

There are no reviews for PRKRIR Recombinant Protein (H00005612-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRKRIR Recombinant Protein (H00005612-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRKRIR Products

Diseases for PRKRIR Recombinant Protein (H00005612-P01)

Discover more about diseases related to PRKRIR Recombinant Protein (H00005612-P01).
 

Pathways for PRKRIR Recombinant Protein (H00005612-P01)

View related products by pathway.

PTMs for PRKRIR Recombinant Protein (H00005612-P01)

Learn more about PTMs related to PRKRIR Recombinant Protein (H00005612-P01).
 

Research Areas for PRKRIR Recombinant Protein (H00005612-P01)

Find related products by research area.

Blogs on PRKRIR

There are no specific blogs for PRKRIR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PRKRIR GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRIR