PRKRIP1 Antibody (M2)

Images

 
Immunohistochemistry-Paraffin: PRKRIP1 Antibody (M2) [H00079706-M08] - Analysis of monoclonal antibody to PRKRIP1 on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 5 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, IHC, IHC-P
Clone
M2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PRKRIP1 Antibody (M2) Summary

Immunogen
PRKRIP1 (AAH14298, 1 a.a. ~ 184 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASPAASSVRPPRPKKEPQTLVIPKNAAEEQKLKLERLMKNPDKAVPIPEKMSEWAPRPPPEFVRDVMGSSAGAGSGEFHVYRHLRRREYQRQDYMDAMAEKQKLYAEFQKRLEKNKIAAEEQTAKRRKKRQKLKEKKLLAKKMKLEQKKQEGPGQPKEQGSSSSAEASGTEEEEEVPSFTMGR
Specificity
PRKRIP1 - PRKR interacting protein 1 (IL11 inducible)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRKRIP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recombinant protein on ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRKRIP1 Antibody (M2)

  • C114
  • FLJ13902
  • FLJ40957
  • KRAB box domain containing 3
  • KRBOX3
  • likely ortholog of mouse C114 dsRNA-binding protein
  • PRKR interacting protein 1 (IL11 inducible)
  • PRKR-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

D1100
Species: Hu
Applications: ELISA
NBP2-02669
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-77266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP1-59506
Species: Hu
Applications: WB
NBP2-47466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56725
Species: Hu, Mu
Applications: Flow-IC, Flow, IHC, IHC-P, IP, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP2-39019
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12391
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IP, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15514
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
H00079706-M08
Species: Hu
Applications: ELISA, IHC, IHC-P

Publications for PRKRIP1 Antibody (H00079706-M08) (0)

There are no publications for PRKRIP1 Antibody (H00079706-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRKRIP1 Antibody (H00079706-M08) (0)

There are no reviews for PRKRIP1 Antibody (H00079706-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRKRIP1 Antibody (H00079706-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRKRIP1 Products

Bioinformatics Tool for PRKRIP1 Antibody (H00079706-M08)

Discover related pathways, diseases and genes to PRKRIP1 Antibody (H00079706-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKRIP1 Antibody (H00079706-M08)

Discover more about diseases related to PRKRIP1 Antibody (H00079706-M08).
 

Pathways for PRKRIP1 Antibody (H00079706-M08)

View related products by pathway.

PTMs for PRKRIP1 Antibody (H00079706-M08)

Learn more about PTMs related to PRKRIP1 Antibody (H00079706-M08).

Blogs on PRKRIP1

There are no specific blogs for PRKRIP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRKRIP1 Antibody (M2) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKRIP1
Entrez
Uniprot