PRHOXNB Antibody

Images

 
Immunohistochemistry-Paraffin: PRHOXNB Antibody [NBP1-90645] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRHOXNB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQEGILRCHPDLAGSELQRGTLTAESQREQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRHOXNB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRHOXNB Protein (NBP1-90645PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRHOXNB Antibody

  • OHCU decarboxylase
  • parahox cluster neighbor
  • parahox neighbor
  • putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
  • URAD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PRHOXNB Antibody (NBP1-90645) (0)

There are no publications for PRHOXNB Antibody (NBP1-90645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRHOXNB Antibody (NBP1-90645) (0)

There are no reviews for PRHOXNB Antibody (NBP1-90645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PRHOXNB Antibody (NBP1-90645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRHOXNB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRHOXNB