PRHOXNB Antibody

Immunohistochemistry-Paraffin: PRHOXNB Antibody [NBP1-90645] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PRHOXNB Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQEGILRCHPDLAGSELQRGTLTAESQREQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRHOXNB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PRHOXNB Protein (NBP1-90645PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PRHOXNB Antibody

• OHCU decarboxylase
• parahox cluster neighbor
• parahox neighbor
• putative 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase
• URAD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRHOXNB