PRDM15 Antibody

Images

 
Western Blot: PRDM15 Antibody [NBP1-52842] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM15 Antibody Summary

Immunogen
Synthetic peptides corresponding to PRDM15(PR domain containing 15) The peptide sequence was selected from the middle region of PRDM15. Peptide sequence LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PRDM15 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PRDM15 Antibody

  • C21orf83
  • chromosome 21 open reading frame 83
  • PFM15
  • PR domain containing 15
  • PR domain zinc finger protein 15
  • PR domain-containing protein 15
  • Zinc finger protein 298
  • ZNF298

Background

The exact function of PRDM15 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7365
Species: Hu, Mu, Rt
Applications: WB
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
H00057154-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00054101-M01
Species: Hu
Applications: WB, ELISA
MAB7442
Species: Hu
Applications: WB, B/N
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF1118
Species: Hu
Applications: WB, IHC
NBP2-48952
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for PRDM15 Antibody (NBP1-52842) (0)

There are no publications for PRDM15 Antibody (NBP1-52842).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM15 Antibody (NBP1-52842) (0)

There are no reviews for PRDM15 Antibody (NBP1-52842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRDM15 Antibody (NBP1-52842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRDM15 Products

Bioinformatics Tool for PRDM15 Antibody (NBP1-52842)

Discover related pathways, diseases and genes to PRDM15 Antibody (NBP1-52842). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRDM15 Antibody (NBP1-52842)

Discover more about diseases related to PRDM15 Antibody (NBP1-52842).
 

Pathways for PRDM15 Antibody (NBP1-52842)

View related products by pathway.

Blogs on PRDM15

There are no specific blogs for PRDM15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM15