PRC1 Recombinant Protein Antigen

Images

 
There are currently no images for PRC1 Recombinant Protein Antigen (NBP3-17008PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PRC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRC1

Source: E. coli

Amino Acid Sequence: DMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRC1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17008.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRC1 Recombinant Protein Antigen

  • anaphase spindle elongation 1 homolog
  • ASE1
  • MGC1671
  • MGC3669
  • protein regulating cytokinesis 1
  • protein regulator of cytokinesis 1

Background

Novel human protein Protein regulator of cytokinesis 1 (PRC1) is involved in cytokinesis. PRC1 is a good substrate for several CDKs in vitro and is phosphorylated in vivo at sites that are phosphorylated by CDK in vitro, strongly suggesting that PRC1 is an in vivo CDK substrate. PRC1 protein levels are high during S and G2/M and drop dramatically after cells exit mitosis and enter G1. PRC1 is a nuclear protein in interphase, becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis (1). PRC1, a mitotic spindle-associated Cdk substrate that is essential to cell cleavage, is a microtubule binding and bundling protein both in vivo and in vitro. Over expression of PRC1 extensively bundles interphase microtubules, but does not affect early mitotic spindle organization (2). PRC1 has been shown to down-regulate the GAP activity of MgcRac-GAP during the metaphase and thereby contributes to the correct formation of the spindle (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1049
Species: Hu
Applications: IHC, WB
H00006045-M01
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
AF4767
Species: Hu, Mu
Applications: ICC, WB
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP2-37370
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP1-82985
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF5827
Species: Hu, Mu
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01109
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB

Publications for PRC1 Recombinant Protein Antigen (NBP3-17008PEP) (0)

There are no publications for PRC1 Recombinant Protein Antigen (NBP3-17008PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRC1 Recombinant Protein Antigen (NBP3-17008PEP) (0)

There are no reviews for PRC1 Recombinant Protein Antigen (NBP3-17008PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRC1 Recombinant Protein Antigen (NBP3-17008PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRC1 Products

Research Areas for PRC1 Recombinant Protein Antigen (NBP3-17008PEP)

Find related products by research area.

Blogs on PRC1

There are no specific blogs for PRC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PRC1