PRAS40 Recombinant Protein Antigen

Images

 
There are currently no images for PRAS40 Recombinant Protein Antigen (NBP2-57165PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PRAS40 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRAS40.

Source: E. coli

Amino Acid Sequence: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AKT1S1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57165.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRAS40 Recombinant Protein Antigen

  • 40 kDa
  • AKT1 substrate 1 (proline-rich)
  • AKT1S1
  • Lobe
  • MGC2865
  • PRAS40
  • proline-rich AKT1 substrate 1,40 kDa proline-rich AKT substrate

Background

Proline Rich Akt Substrate (PRAS40) is a 40 kDa substrate of Akt. Akt and PRAS40 can be found in the phosphoinositide 3 kinase (PI3K) pathway, which plays a role in glucose uptake, cell growth, and apoptosis inhibition. PRAS40 is a 14-3-3 binding protein that reacts with insulin, but whose precise function is not yet known. It may bind SH3 and WW domain containing proteins resulting in a change of function. Activated Akt phosphorylates PRAS40 on threonine 246. Mutation of PRAS40 threonine 246 has been shown to be apoptotic.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-24837
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-157
Species: Hu
Applications: IHC,  IHC-P, KO, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF3918
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF4589
Species: Hu
Applications: IHC, WB
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-67552
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF8962
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
AF847
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
H00006009-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB

Publications for PRAS40 Recombinant Protein Antigen (NBP2-57165PEP) (0)

There are no publications for PRAS40 Recombinant Protein Antigen (NBP2-57165PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAS40 Recombinant Protein Antigen (NBP2-57165PEP) (0)

There are no reviews for PRAS40 Recombinant Protein Antigen (NBP2-57165PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRAS40 Recombinant Protein Antigen (NBP2-57165PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRAS40 Products

Research Areas for PRAS40 Recombinant Protein Antigen (NBP2-57165PEP)

Find related products by research area.

Blogs on PRAS40.

Mapping Signal Transduction with mTOR Antibodies
The protein encoded by mTOR (mammalian target of rapamycin), also known as dTOR in Drosophila, belongs to a family of phosphatidylinositol kinase-related kinases. These kinases regulate fundamental processes of cell growth, proliferation, metabolism...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRAS40 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AKT1S1