PQBP1 Antibody [DyLight 680] Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human PQBP1 (NP_005701.1).
Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PQBP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for PQBP1 Antibody [DyLight 680]
Background
PQBP1, also known as Polyglutamine-binding protein 1, is a nuclear polyglutamine-binding protein that may play a role in apoptosis and DNA replication. Ten isoforms of PQBP1 have been identified which are produced by alternative splicing. The canonical sequence, referred to as PQBP-1, is 265 amino acids long and approximately 30kdA. PQBP1 may be implicated in an x-linked mental retardation syndrome called Renpenning syndrome 1 (RENS1), as well as neurodegenerative diseases, coloboma, spastic diplegia, ataxia and neuronitis. PQBP1 has also been shown to interact with C14orf1, MED31, WBP11, CLTB, and SF3A2.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, Neut, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for PQBP1 Antibody (NBP3-38089FR) (0)
There are no publications for PQBP1 Antibody (NBP3-38089FR).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PQBP1 Antibody (NBP3-38089FR) (0)
There are no reviews for PQBP1 Antibody (NBP3-38089FR).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PQBP1 Antibody (NBP3-38089FR) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PQBP1 Products
Research Areas for PQBP1 Antibody (NBP3-38089FR)
Find related products by research area.
|
Blogs on PQBP1