New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Recombinant Human PPP1R7 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PPP1R7 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human PPP1R7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPP1R7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPP1R7 GST (N-Term) Protein

  • Protein phosphatase 1 regulatory subunit 22
  • protein phosphatase 1 regulatory subunit 7
  • protein phosphatase 1, regulatory (inhibitor) subunit 7
  • protein phosphatase-1 regulatory subunit 7 alpha2
  • protein phosphatase-1 regulatory subunit 7 beta1
  • protein phosphatase-1 regulatory subunit 7 beta2
  • regulatory subunit 7
  • sds22

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-85409
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-32858
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-90113
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-89165
Species: Hu
Applications: IHC, IHC-P
NBP1-70681
Species: Hu
Applications: WB
NBP2-67695
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34685
Species: Hu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-338
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
NBP2-67764
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for PPP1R7 Partial Recombinant Protein (H00005510-Q01) (0)

There are no publications for PPP1R7 Partial Recombinant Protein (H00005510-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R7 Partial Recombinant Protein (H00005510-Q01) (0)

There are no reviews for PPP1R7 Partial Recombinant Protein (H00005510-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP1R7 Partial Recombinant Protein (H00005510-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP1R7 Products

Bioinformatics Tool for PPP1R7 Partial Recombinant Protein (H00005510-Q01)

Discover related pathways, diseases and genes to PPP1R7 Partial Recombinant Protein (H00005510-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP1R7 Partial Recombinant Protein (H00005510-Q01)

Discover more about diseases related to PPP1R7 Partial Recombinant Protein (H00005510-Q01).
 

Pathways for PPP1R7 Partial Recombinant Protein (H00005510-Q01)

View related products by pathway.

PTMs for PPP1R7 Partial Recombinant Protein (H00005510-Q01)

Learn more about PTMs related to PPP1R7 Partial Recombinant Protein (H00005510-Q01).
 

Research Areas for PPP1R7 Partial Recombinant Protein (H00005510-Q01)

Find related products by research area.

Blogs on PPP1R7

There are no specific blogs for PPP1R7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPP1R7 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R7