PPIL5 Recombinant Protein Antigen

Images

 
There are currently no images for PPIL5 Recombinant Protein Antigen (NBP2-49457PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPIL5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIL5.

Source: E. coli

Amino Acid Sequence: GSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LRR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49457.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPIL5 Recombinant Protein Antigen

  • 4-1BBlrr
  • cyclophilin-like 5,4-1BB-mediated-signaling molecule
  • leucine rich repeat protein 1
  • LRR-1LRR-repeat protein 1
  • MGC20689,4-1BBLRR
  • peptidylprolyl isomerase (cyclophilin)-like 5,4-1BB-mediated signaling molecule
  • Peptidylprolyl isomerase-like 5
  • PPIL5

Background

PPIL5 is encoded by this gene contains a leucine-rich repeat (LRR). It specifically interacts with TNFRSF9/4-1BB, a member of the tumor necrosis factor receptor (TNFR) superfamily. Overexpression of this gene suppresses the activation of NF-kappa B induced by TNFRSF9 or TNF receptor-associated factor 2 (TRAF2), which suggests that this protein is a negative regulator of TNFRSF9-mediated signaling cascades. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF546
Species: Mu
Applications: CyTOF-ready, Flow, Neut, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
3047-CC
Species: Hu
Applications: BA
NBP1-49873
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF838
Species: Hu
Applications: AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
NBP1-54899
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP1-85630
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56637
Species: Hu, Mu
Applications: WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD

Publications for PPIL5 Recombinant Protein Antigen (NBP2-49457PEP) (0)

There are no publications for PPIL5 Recombinant Protein Antigen (NBP2-49457PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPIL5 Recombinant Protein Antigen (NBP2-49457PEP) (0)

There are no reviews for PPIL5 Recombinant Protein Antigen (NBP2-49457PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPIL5 Recombinant Protein Antigen (NBP2-49457PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPIL5 Products

Blogs on PPIL5

There are no specific blogs for PPIL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPIL5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol LRR1