PPIL4 Antibody (1C10) - Azide and BSA Free

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01] - PPIL4 monoclonal antibody (M01), clone 1C10 Analysis of PPIL4 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: PPIL4 Antibody (1C10) [H00085313-M01] - Analysis of monoclonal antibody to PPIL4 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01] - Analysis of PPIL4 over-expressed 293 cell line, cotransfected with PPIL4 Validated Chimera RNAi ( Cat # H00085313-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPIL4 monoclonal antibody (M01), clone 1C10 (Cat # H00085313-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: PPIL4 Antibody (1C10) [H00085313-M01] - Analysis of PPIL4 expression in transfected 293T cell line by PPIL4 monoclonal antibody (M01), clone 1C10.Lane 1: PPIL4 transfected lysate(57.2 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, KD
• Clone: 1C10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PPIL4 Antibody (1C10) - Azide and BSA Free Summary

• Immunogen: PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLY
• Specificity: PPIL4 - peptidylprolyl isomerase (cyclophilin)-like 4
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PPIL4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Knockdown Validated
  • Western Blot
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPIL4 Antibody (1C10) - Azide and BSA Free

• Cyclophilin-like protein PPIL4
• cyclophilin-type peptidyl-prolyl cis-trans isomerase
• EC 5.2.1.8
• HDCME13P
• peptidyl-prolyl cis-trans isomerase-like 4
• peptidylprolyl isomerase (cyclophilin)-like 4
• PPIase
• Rotamase PPIL4
• serologically defined breast cancer antigen NY-BR-18

Background

This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPIL4
• Entrez:
  • 85313(Human)
• OMIM:
  • 607609(Human)
• Uniprot:
  • NP_624311(Human)