Recombinant Human PPAP2C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPAP2C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 114-166 of Human PPAP2C partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DLAKYMIGRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPAP2C
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPAP2C Protein

  • EC 3.1.3.4
  • LPP2PAP2-g
  • PAP2c
  • PAP-2clipid phosphate phosphohydrolase 2
  • PAP2-G
  • PAP2-gamma
  • Phosphatidate phosphohydrolase type 2c
  • Phosphatidic acid phosphatase 2c
  • phosphatidic acid phosphatase type 2C
  • phosphatidic acid phosphohydrolase type 2c
  • type-2 phosphatidic acid phosphatase-gamma

Background

PPAP2C - phosphatidic acid phosphatase type 2C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-45378
Species: Hu
Applications: WB, IHC
NBP2-57350
Species: Hu
Applications: WB, ICC/IF
NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
H00008720-M07
Species: Hu
Applications: ELISA, ICC/IF
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-88792
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-32482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PPAP2C Partial Recombinant Protein (H00008612-Q01) (0)

There are no publications for PPAP2C Partial Recombinant Protein (H00008612-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAP2C Partial Recombinant Protein (H00008612-Q01) (0)

There are no reviews for PPAP2C Partial Recombinant Protein (H00008612-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAP2C Partial Recombinant Protein (H00008612-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPAP2C Products

Bioinformatics Tool for PPAP2C Partial Recombinant Protein (H00008612-Q01)

Discover related pathways, diseases and genes to PPAP2C Partial Recombinant Protein (H00008612-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPAP2C Partial Recombinant Protein (H00008612-Q01)

Discover more about diseases related to PPAP2C Partial Recombinant Protein (H00008612-Q01).
 

Pathways for PPAP2C Partial Recombinant Protein (H00008612-Q01)

View related products by pathway.

Blogs on PPAP2C

There are no specific blogs for PPAP2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PPAP2C Antibody
NBP2-31607

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPAP2C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPAP2C