Recombinant Human PP1 Inhibitor-2 Protein

Images

 
Recombinant Human PP1 Inhibitor-2 Protein [H00005504-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human PP1 Inhibitor-2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human PP1 Inhibitor-2

Source: Wheat Germ

Amino Acid Sequence: MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPP1R2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PP1 Inhibitor-2 Protein

  • IPP2
  • IPP-2
  • IPP2phosphatase inhibitor 2
  • MGC87148
  • phosphoprotein phosphatase
  • PP1 Inhibitor2
  • PP1 Inhibitor-2
  • PPP1R2
  • protein phosphatase 1, regulatory (inhibitor) subunit 2
  • protein phosphatase inhibitor 2

Background

PPP1R2 - protein phosphatase 1, regulatory (inhibitor) subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP2-37530
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-67695
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-32618
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NBP1-57033
Species: Hu
Applications: WB
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81334
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85862
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01) (0)

There are no publications for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01) (0)

There are no reviews for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01)

Discover related pathways, diseases and genes to PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01)

Discover more about diseases related to PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01).
 

Pathways for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01)

View related products by pathway.

PTMs for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01)

Learn more about PTMs related to PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01).
 

Research Areas for PP1 Inhibitor-2 Partial Recombinant Protein (H00005504-Q01)

Find related products by research area.

Blogs on PP1 Inhibitor-2

There are no specific blogs for PP1 Inhibitor-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

eNOS Antibody
NB300-500

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PP1 Inhibitor-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R2