POU6F1 Antibody (6F10)

Images

 
Western Blot: POU6F1 Antibody (6F10) [H00005463-M03] - Analysis of POU6F1 expression in Jurkat (Cat # L017V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6F10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POU6F1 Antibody (6F10) Summary

Immunogen
POU6F1 (NP_002693 193 a.a. - 301 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Specificity
POU6F1 (6F10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POU6F1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POU6F1 Antibody (6F10)

  • Brain-specific homeobox/POU domain protein 5
  • Brn-5
  • BRN5brain-5
  • mPOU homeobox protein
  • MPOUbrn-5
  • POU class 6 homeobox 1
  • POU domain, class 6, transcription factor 1
  • TCFB1Brain-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NB100-757
Species: Hu
Applications: WB, IHC-P
NBP2-58020
Species: Hu
Applications: ICC/IF
NBP2-26061
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, PEP-ELISA
NBP1-89934
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61436
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-92273
Species: Hu
Applications: IHC, IHC-P
NBP2-24689
Species: Hu, Mu
Applications: WB
AF2567
Species: Mu
Applications: WB, IHC
NB100-79802
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, PLA
27570002
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-49872
Species: Mu, Rt
Applications: WB, PEP-ELISA
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow

Publications for POU6F1 Antibody (H00005463-M03) (0)

There are no publications for POU6F1 Antibody (H00005463-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU6F1 Antibody (H00005463-M03) (0)

There are no reviews for POU6F1 Antibody (H00005463-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POU6F1 Antibody (H00005463-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POU6F1 Products

Bioinformatics Tool for POU6F1 Antibody (H00005463-M03)

Discover related pathways, diseases and genes to POU6F1 Antibody (H00005463-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POU6F1 Antibody (H00005463-M03)

Discover more about diseases related to POU6F1 Antibody (H00005463-M03).
 

Pathways for POU6F1 Antibody (H00005463-M03)

View related products by pathway.

PTMs for POU6F1 Antibody (H00005463-M03)

Learn more about PTMs related to POU6F1 Antibody (H00005463-M03).

Blogs on POU6F1

There are no specific blogs for POU6F1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POU6F1 Antibody (6F10) and receive a gift card or discount.

Bioinformatics

Gene Symbol POU6F1
Entrez
Uniprot