POU3F2/OCT7 Recombinant Protein Antigen

Images

 
There are currently no images for POU3F2/OCT7 Recombinant Protein Antigen (NBP2-55453PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POU3F2/OCT7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POU3F2/OCT7.

Source: E. coli

Amino Acid Sequence: ASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POU3F2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55453.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POU3F2/OCT7 Recombinant Protein Antigen

  • Brain-2
  • Brain-specific homeobox/POU domain protein 2
  • BRN2
  • brn-2
  • BRN2brain-2
  • Nervous system-specific octamer-binding transcription factor N-Oct-3
  • Oct7
  • oct-7
  • OCT7POU domain class 3, transcription factor 2
  • Octamer-binding protein 7
  • Octamer-binding transcription factor 7
  • OTF7
  • OTF-7
  • POU class 3 homeobox 2
  • POU domain, class 3, transcription factor 2
  • POU3F2
  • POUF3

Background

POU3F2 belongs to a large family of transcription factors that bind to the octameric DNA sequence ATGCAAAT. Most of these proteins share a highly homologous region, referred to as the POU domain, that occurs in several mammalian transcription factors, including the octamer-binding proteins Oct1 (POU2F1; MIM 164175) and Oct2 (POU2F2; MIM 164176) and the pituitary protein Pit1 (PIT1; MIM 173110). Class III POU genes are expressed predominantly in the central nervous system (CNS). It is likely that CNS-specific transcription factors such as these play an important role in mammalian neurogenesis by regulating their diverse patterns of gene expression (Schreiber et al., 1993 [PubMed 8441633]; Atanasoski et al., 1995 [PubMed 7601453]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49872
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
AF5769
Species: Hu
Applications: IHC, WB
NBP3-13349
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-68787
Species: Hu
Applications: ICC/IF, WB
NBP2-21584
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF2567
Species: Mu
Applications: IHC, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP3-11884
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, RIA, WB
1290-IL
Species: Hu
Applications: BA
NBP1-33581
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P
NBP2-13215
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-75734
Species: Hu
Applications: ELISA, IHC,  IHC-P, PA, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
NB100-55400
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA
NBP2-80261
Applications: ELISA

Publications for POU3F2/OCT7 Recombinant Protein Antigen (NBP2-55453PEP) (0)

There are no publications for POU3F2/OCT7 Recombinant Protein Antigen (NBP2-55453PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POU3F2/OCT7 Recombinant Protein Antigen (NBP2-55453PEP) (0)

There are no reviews for POU3F2/OCT7 Recombinant Protein Antigen (NBP2-55453PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POU3F2/OCT7 Recombinant Protein Antigen (NBP2-55453PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POU3F2/OCT7 Products

Research Areas for POU3F2/OCT7 Recombinant Protein Antigen (NBP2-55453PEP)

Find related products by research area.

Blogs on POU3F2/OCT7.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POU3F2/OCT7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POU3F2