Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10)

Immunocytochemistry/Immunofluorescence: Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) [H00002589-M10] - Analysis of monoclonal antibody to GALNT1 on HeLa cell. Antibody concentration 10 ug/ml

ELISA: Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) [H00002589-M10] - Detection limit for recombinant GST tagged GALNT1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3C10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) Summary

• Immunogen: GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
• Specificity: GALNT1 - UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) (3C10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GALNT1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10)

• EC 2.4.1.41
• GalNAc transferase 1
• GALNAC-T1
• GALNT1
• Polypeptide GalNAc transferase 1
• polypeptide N-acetylgalactosaminyltransferase 1
• pp-GaNTase 1
• Protein-UDP acetylgalactosaminyltransferase 1
• UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
• UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1)

Background

This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GALNT1
• Entrez:
  • 2589(Human)
• Uniprot:
  • NP_065207(Human)