Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV |
| Specificity |
GALNT1 - UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) (3C10) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
GALNT1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) - Azide and BSA Free
Background
This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu
Applications: IHC-P
Species: Mu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Publications for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10)(1)
Showing Publication 1 -
1 of 1.
Reviews for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10) (0)
There are no reviews for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Polypeptide GalNac Transferase 1/GALNT1 Products
Research Areas for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10)
Find related products by research area.
|
Blogs on Polypeptide GalNac Transferase 1/GALNT1