Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10)

Images

 
Immunocytochemistry/ Immunofluorescence: Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) [H00002589-M10] - Analysis of monoclonal antibody to GALNT1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) [H00002589-M10] - Detection limit for recombinant GST tagged GALNT1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
3C10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) Summary

Immunogen
GALNT1 (NP_065207, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV
Specificity
GALNT1 - UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) (3C10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GALNT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10)

  • EC 2.4.1.41
  • GalNAc transferase 1
  • GALNAC-T1
  • GALNT1
  • Polypeptide GalNAc transferase 1
  • polypeptide N-acetylgalactosaminyltransferase 1
  • pp-GaNTase 1
  • Protein-UDP acetylgalactosaminyltransferase 1
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 1
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 1 (GalNAc-T1)

Background

This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF7507
Species: Hu
Applications: ICC, WB
AF7174
Species: Hu
Applications: ICC, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88662
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF7528
Species: Hu
Applications: WB
NBP1-97308
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-84047
Species: Hu
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
259-HE/CF
Species: Hu
Applications: BA
NBP1-87850
Species: Hu
Applications: IHC, IHC-P
NBP2-25250
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-86893
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-06499
Species: Hu
Applications: IHC, IHC-P, IP, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO

Publications for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10) (0)

There are no publications for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10) (0)

There are no reviews for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Polypeptide GalNac Transferase 1/GALNT1 Products

Bioinformatics Tool for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10)

Discover related pathways, diseases and genes to Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10)

Discover more about diseases related to Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10).
 

Pathways for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10)

View related products by pathway.

PTMs for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10)

Learn more about PTMs related to Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10).
 

Research Areas for Polypeptide GalNac Transferase 1/GALNT1 Antibody (H00002589-M10)

Find related products by research area.

Blogs on Polypeptide GalNac Transferase 1/GALNT1

There are no specific blogs for Polypeptide GalNac Transferase 1/GALNT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Polypeptide GalNac Transferase 1/GALNT1 Antibody (3C10) and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT1
Entrez
Uniprot