Recombinant Human POLR3A Protein

Images

 
Recombinant Human POLR3A Protein [H00011128-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POLR3A Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 111-209 of Human POLR3A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TCCHIMLSQEEKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSNFLQSFETAIEHNKEVEP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POLR3A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POLR3A Protein

  • DNA-directed RNA polymerase III largest subunit
  • DNA-directed RNA polymerase III subunit A
  • DNA-directed RNA polymerase III subunit RPC1
  • EC 2.7.7.6
  • hRPC155
  • POL3A
  • polymerase (RNA) III (DNA directed) polypeptide A, 155kDa
  • RNA polymerase III 155 kDa subunit
  • RNA polymerase III subunit C160
  • RNA polymerase III subunit RPC155-D
  • RPC1
  • RPC155RNA polymerase III subunit C1

Background

POLR3A - polymerase (RNA) III (DNA directed) polypeptide A, 155kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-57578
Species: Hu
Applications: WB
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45900
Species: Hu
Applications: WB, IHC, IF
NBP2-49530
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-88036
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
H00011128-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for POLR3A Partial Recombinant Protein (H00011128-Q01) (0)

There are no publications for POLR3A Partial Recombinant Protein (H00011128-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR3A Partial Recombinant Protein (H00011128-Q01) (0)

There are no reviews for POLR3A Partial Recombinant Protein (H00011128-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR3A Partial Recombinant Protein (H00011128-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLR3A Products

Bioinformatics Tool for POLR3A Partial Recombinant Protein (H00011128-Q01)

Discover related pathways, diseases and genes to POLR3A Partial Recombinant Protein (H00011128-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR3A Partial Recombinant Protein (H00011128-Q01)

Discover more about diseases related to POLR3A Partial Recombinant Protein (H00011128-Q01).
 

Pathways for POLR3A Partial Recombinant Protein (H00011128-Q01)

View related products by pathway.

PTMs for POLR3A Partial Recombinant Protein (H00011128-Q01)

Learn more about PTMs related to POLR3A Partial Recombinant Protein (H00011128-Q01).

Blogs on POLR3A

There are no specific blogs for POLR3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POLR3A Antibody
NBP1-83204

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POLR3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR3A