POLR2J Antibody (1A10)

Images

 
Western Blot: POLR2J Antibody (1A10) [H00005439-M02] - Analysis of POLR2J expression in transfected 293T cell line by POLR2J monoclonal antibody (M02), clone 1A10.Lane 1: POLR2J transfected lysate(13.3 KDa).Lane 2: ...read more
Sandwich ELISA: POLR2J Antibody (1A10) [H00005439-M02] - Detection limit for recombinant GST tagged POLR2J is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POLR2J Antibody (1A10) Summary

Immunogen
POLR2J (AAH24165, 1 a.a. - 117 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Specificity
POLR2J - polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa (1A10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLR2J
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLR2J Antibody (1A10)

  • DNA-directed RNA polymerase II subunit J-1
  • DNA-directed RNA polymerase II subunit RPB11-a
  • hRPB14
  • MGC71910
  • POLR2J1RNA polymerase II subunit B11-a
  • polymerase (RNA) II (DNA directed) polypeptide J (13.3kD)
  • polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
  • RNA polymerase II 13.3 kDa subunit
  • RPB11
  • RPB11A
  • RPB11m

Background

This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19885
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53092
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-598
Species: Hu, Mu, Ye, Pm(-)
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IP, CyTOF-ready, Flow-IC
NBP2-00482
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-80816
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009533-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-14254
Species: Hu, Mu
Applications: WB, IHC
NBP2-47329
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55856
Species: Hu
Applications: ICC/IF
NBP2-03649
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92344
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005439-M02
Species: Hu
Applications: WB, ELISA

Publications for POLR2J Antibody (H00005439-M02) (0)

There are no publications for POLR2J Antibody (H00005439-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR2J Antibody (H00005439-M02) (0)

There are no reviews for POLR2J Antibody (H00005439-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR2J Antibody (H00005439-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR2J Products

Bioinformatics Tool for POLR2J Antibody (H00005439-M02)

Discover related pathways, diseases and genes to POLR2J Antibody (H00005439-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR2J Antibody (H00005439-M02)

Discover more about diseases related to POLR2J Antibody (H00005439-M02).
 

Pathways for POLR2J Antibody (H00005439-M02)

View related products by pathway.

PTMs for POLR2J Antibody (H00005439-M02)

Learn more about PTMs related to POLR2J Antibody (H00005439-M02).

Blogs on POLR2J

There are no specific blogs for POLR2J, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR2J Antibody (1A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2J
Entrez
Uniprot