Recombinant Human POLN Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human POLN Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 100 of Human POLN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVDSKTWGKSTETMEVINKSSVKYSVQLEDRKTQSPEKKDLKSLRSQTSRGSAKLSPQSFSVRLTDQL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
POLN
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human POLN Protein

  • DNA polymerase N
  • DNA polymerase nu
  • DNA polymerase POL4P
  • EC 2.7.7.7
  • POL4P
  • polymerase (DNA directed) nu

Background

POLN - polymerase (DNA directed) nu

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010721-M09
Species: Hu
Applications: WB, ELISA
H00051426-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00023499-M08
Species: Hu
Applications: WB, ELISA
NBP2-38600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-91842
Species: Hu
Applications: IHC, IHC-P
NBP1-44261
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF3417
Species: Hu
Applications: WB
NBP1-84289
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56357
Species: Hu
Applications: WB, IP
NBP2-14870
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
H00353497-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for POLN Partial Recombinant Protein (H00353497-Q01) (0)

There are no publications for POLN Partial Recombinant Protein (H00353497-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLN Partial Recombinant Protein (H00353497-Q01) (0)

There are no reviews for POLN Partial Recombinant Protein (H00353497-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLN Partial Recombinant Protein (H00353497-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POLN Products

Bioinformatics Tool for POLN Partial Recombinant Protein (H00353497-Q01)

Discover related pathways, diseases and genes to POLN Partial Recombinant Protein (H00353497-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLN Partial Recombinant Protein (H00353497-Q01)

Discover more about diseases related to POLN Partial Recombinant Protein (H00353497-Q01).
 

Pathways for POLN Partial Recombinant Protein (H00353497-Q01)

View related products by pathway.

Blogs on POLN

There are no specific blogs for POLN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182
POLN Antibody
NBP2-58779

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human POLN Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol POLN