PNUTS/PPP1R10 Antibody (1D6) - Azide and BSA Free

Western Blot: PNUTS/PPP1R10 Antibody (1D6) [H00005514-M02] - Analysis of PPP1R10 expression in transfected 293T cell line by PPP1R10 monoclonal antibody (M02), clone 1D6.Lane 1: PPP1R10 transfected lysate(99.1 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PNUTS/PPP1R10 Antibody (1D6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: PPP1R10 (NP_002705.2, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PPP1R10
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PNUTS/PPP1R10 Antibody (1D6) - Azide and BSA Free

• CAT53
• FB19PP1-binding protein of 114 kDa
• MHC class I region proline-rich protein CAT53
• p99
• Phosphatase 1 nuclear targeting subunit
• phosphatase nuclear targeting subunit
• PNUTS
• PNUTSPP1R10
• PPP1R10
• Protein FB19
• protein phosphatase 1 regulatory subunit 10
• protein phosphatase 1, regulatory (inhibitor) subunit 10
• protein phosphatase 1, regulatory subunit 10
• serine/threonine-protein phosphatase 1 regulatory subunit 10

Background

Protein phosphatase 1 (PP1) is found in the cell nucleus and has been implicated in several aspects of nuclear function. Phosphatase 1 nuclear targeting subunit (PNUTS) is a novel protein that exhibits a discreet nuclear compartmentalization and is colocalized with chromatin at distinct phases during mitosis. The subcellular localization of PP1 and the activity toward substrates involved in many aspects of cell physiology have previously been shown to be regulated by association with noncatalytic targeting subunits. The properties of PNUTS are consistent with its role as a targeting subunit for the regulation of nuclear PP1 function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R10
• Uniprot:
  • NP_002705()