PNUTS/PPP1R10 Antibody (1D6)

Images

 
Western Blot: PNUTS/PPP1R10 Antibody (1D6) [H00005514-M02] - Analysis of PPP1R10 expression in transfected 293T cell line by PPP1R10 monoclonal antibody (M02), clone 1D6.Lane 1: PPP1R10 transfected lysate(99.1 KDa).Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1D6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PNUTS/PPP1R10 Antibody (1D6) Summary

Immunogen
PPP1R10 (NP_002705.2, 1 a.a. - 83 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPP1R10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PNUTS/PPP1R10 Antibody (1D6)

  • CAT53
  • FB19PP1-binding protein of 114 kDa
  • MHC class I region proline-rich protein CAT53
  • p99
  • Phosphatase 1 nuclear targeting subunit
  • phosphatase nuclear targeting subunit
  • PNUTS
  • PNUTSPP1R10
  • PPP1R10
  • Protein FB19
  • protein phosphatase 1 regulatory subunit 10
  • protein phosphatase 1, regulatory (inhibitor) subunit 10
  • protein phosphatase 1, regulatory subunit 10
  • serine/threonine-protein phosphatase 1 regulatory subunit 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88433
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-57428
Species: Hu
Applications: WB, ICC/IF
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-24490
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP1-90111
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB600-210
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005514-M02
Species: Hu
Applications: WB, ELISA

Publications for PNUTS/PPP1R10 Antibody (H00005514-M02) (0)

There are no publications for PNUTS/PPP1R10 Antibody (H00005514-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNUTS/PPP1R10 Antibody (H00005514-M02) (0)

There are no reviews for PNUTS/PPP1R10 Antibody (H00005514-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNUTS/PPP1R10 Antibody (H00005514-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNUTS/PPP1R10 Products

Bioinformatics Tool for PNUTS/PPP1R10 Antibody (H00005514-M02)

Discover related pathways, diseases and genes to PNUTS/PPP1R10 Antibody (H00005514-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNUTS/PPP1R10 Antibody (H00005514-M02)

Discover more about diseases related to PNUTS/PPP1R10 Antibody (H00005514-M02).
 

Pathways for PNUTS/PPP1R10 Antibody (H00005514-M02)

View related products by pathway.

PTMs for PNUTS/PPP1R10 Antibody (H00005514-M02)

Learn more about PTMs related to PNUTS/PPP1R10 Antibody (H00005514-M02).
 

Research Areas for PNUTS/PPP1R10 Antibody (H00005514-M02)

Find related products by research area.

Blogs on PNUTS/PPP1R10

There are no specific blogs for PNUTS/PPP1R10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNUTS/PPP1R10 Antibody (1D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R10
Entrez
Uniprot