PNPLA8 Antibody


Western Blot: PNPLA8 Antibody [NBP1-54326] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

PNPLA8 Antibody Summary

Synthetic peptides corresponding to PNPLA8(patatin-like phospholipase domain containing 8) The peptide sequence was selected from the middle region of PNPLA8. Peptide sequence IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PNPLA8 and was validated on Western blot.
Theoretical MW
88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PNPLA8 Antibody

  • calcium-independent phospholipase A2-gamma
  • EC
  • Intracellular membrane-associated calcium-independent phospholipase A2 gamma
  • iPLA2 gamma
  • IPLA22
  • IPLA2-2
  • iPLA2-gamma
  • membrane-associated calcium-independent phospholipase A2 gamma
  • patatin-like phospholipase domain containing 8
  • Patatin-like phospholipase domain-containing protein 8
  • PNPLA-gamma


Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PNPLA8 Antibody (NBP1-54326) (0)

There are no publications for PNPLA8 Antibody (NBP1-54326).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNPLA8 Antibody (NBP1-54326) (0)

There are no reviews for PNPLA8 Antibody (NBP1-54326). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNPLA8 Antibody (NBP1-54326) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PNPLA8 Products

Bioinformatics Tool for PNPLA8 Antibody (NBP1-54326)

Discover related pathways, diseases and genes to PNPLA8 Antibody (NBP1-54326). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNPLA8 Antibody (NBP1-54326)

Discover more about diseases related to PNPLA8 Antibody (NBP1-54326).

Pathways for PNPLA8 Antibody (NBP1-54326)

View related products by pathway.

Blogs on PNPLA8

There are no specific blogs for PNPLA8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PNPLA8 Antibody and receive a gift card or discount.


Gene Symbol PNPLA8