PNPLA8 Antibody

Western Blot: PNPLA8 Antibody [NBP1-54326] - 293T cells lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PNPLA8 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PNPLA8(patatin-like phospholipase domain containing 8) The peptide sequence was selected from the middle region of PNPLA8. Peptide sequence IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PNPLA8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against PNPLA8 and was validated on Western blot.
• Theoretical MW: 88 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PNPLA8 Antibody

• calcium-independent phospholipase A2-gamma
• EC 3.1.1.5
• Intracellular membrane-associated calcium-independent phospholipase A2 gamma
• iPLA2 gamma
• IPLA22
• IPLA2-2
• iPLA2-gamma
• IPLA2GIPLA2(GAMMA)
• membrane-associated calcium-independent phospholipase A2 gamma
• patatin-like phospholipase domain containing 8
• Patatin-like phospholipase domain-containing protein 8
• PNPLA-gamma

Background

Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PNPLA8
• Uniprot:
  • Q9NP80(Human)