PMP70 Recombinant Protein Antigen

Images

 
There are currently no images for PMP70 Recombinant Protein Antigen (NBP2-38199PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PMP70 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PMP70.

Source: E. coli

Amino Acid Sequence: MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCD3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38199.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PMP70 Recombinant Protein Antigen

  • 70 kDa peroxisomal membrane protein
  • ABC43
  • ATP-binding cassette, sub-family D (ALD), member 3
  • peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
  • Peroxisomal membrane protein-1 (70kD)
  • PMP70ATP-binding cassette sub-family D member 3
  • PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
  • ZWS2

Background

PMP70 is encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, KO, WB
NBP3-48249
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-21601
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-94643
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-46842
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-80913
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC,  IHC-P, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP3-46202
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-74503
Species: Mu, Rt
Applications: ICC/IF, WB

Publications for PMP70 Recombinant Protein Antigen (NBP2-38199PEP) (0)

There are no publications for PMP70 Recombinant Protein Antigen (NBP2-38199PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMP70 Recombinant Protein Antigen (NBP2-38199PEP) (0)

There are no reviews for PMP70 Recombinant Protein Antigen (NBP2-38199PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PMP70 Recombinant Protein Antigen (NBP2-38199PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PMP70 Products

Array NBP2-38199PEP

Research Areas for PMP70 Recombinant Protein Antigen (NBP2-38199PEP)

Find related products by research area.

Blogs on PMP70

There are no specific blogs for PMP70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PMP70 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCD3