We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human PMP70 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Endotoxin, AP

Order Details

Recombinant Human PMP70 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 351-449 of Human PMP70

Source: Wheat Germ (in vitro)

Amino Acid Sequence: SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLAT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ABCD3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PMP70 GST (N-Term) Protein

  • 70 kDa peroxisomal membrane protein
  • ABC43
  • ATP-binding cassette, sub-family D (ALD), member 3
  • peroxisomal membrane protein 1 (70kD, Zellweger syndrome)
  • Peroxisomal membrane protein-1 (70kD)
  • PMP70ATP-binding cassette sub-family D member 3
  • PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1))
  • ZWS2

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46476
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, KO, WB
NBP1-33435
Species: Hu
Applications: WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-21601
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-94643
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-46842
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-80950
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-33455
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-32925
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-44912
Species: Hu, Mu, Rt
Applications: IHC, WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP3-46202
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, WB
NBP1-30032
Species: Bv, Ca, Fe, Hu, Mu, Xp
Applications: ICC/IF, IHC, IHC-Fr, KO, WB
NBP1-87185
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87781
Species: Hu
Applications: IHC,  IHC-P

Publications for PMP70 Partial Recombinant Protein (H00005825-Q01) (0)

There are no publications for PMP70 Partial Recombinant Protein (H00005825-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMP70 Partial Recombinant Protein (H00005825-Q01) (0)

There are no reviews for PMP70 Partial Recombinant Protein (H00005825-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PMP70 Partial Recombinant Protein (H00005825-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PMP70 Products

Array H00005825-Q01

Research Areas for PMP70 Partial Recombinant Protein (H00005825-Q01)

Find related products by research area.

Blogs on PMP70

There are no specific blogs for PMP70, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PMP70 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCD3