PMCA4 Antibody

Images

 
Western Blot: PMCA4 Antibody [NBP1-59481] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PMCA4 Antibody Summary

Immunogen
Synthetic peptides corresponding to ATP2B4(ATPase, Ca++ transporting, plasma membrane 4) The peptide sequence was selected from the middle region of ATP2B4. Peptide sequence FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP2B4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ATP2B4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PMCA4 Antibody

  • ATP2B2plasma membrane calcium ATPase
  • ATPase, Ca++ transporting, plasma membrane 4
  • DKFZp686G08106
  • DKFZp686M088
  • EC 3.6.3
  • EC 3.6.3.8
  • Matrix-remodeling-associated protein 1
  • matrix-remodelling associated 1
  • MXRA1
  • Plasma membrane calcium ATPase isoform 4
  • Plasma membrane calcium pump isoform 4
  • plasma membrane calcium pump
  • plasma membrane calcium-transporting ATPase 4
  • PMCA4b
  • PMCA4PMCA4x
  • sarcolemmal calcium pump

Background

ATP2B4 belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. ATP2B4 is the plasma membrane calcium ATPase isoform 4.The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-578
Species: Hu, Mu, Rt, Po, Am, Ca, Ch, Fe, Ha, Pm, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-87259
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
H00000489-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-56483
Species: Hu
Applications: ICC/IF
NBP1-76566
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NBP2-30046
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NB300-622
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for PMCA4 Antibody (NBP1-59481) (0)

There are no publications for PMCA4 Antibody (NBP1-59481).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMCA4 Antibody (NBP1-59481) (0)

There are no reviews for PMCA4 Antibody (NBP1-59481). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PMCA4 Antibody (NBP1-59481) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PMCA4 Antibody (NBP1-59481)

Discover related pathways, diseases and genes to PMCA4 Antibody (NBP1-59481). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMCA4 Antibody (NBP1-59481)

Discover more about diseases related to PMCA4 Antibody (NBP1-59481).
 

Pathways for PMCA4 Antibody (NBP1-59481)

View related products by pathway.

PTMs for PMCA4 Antibody (NBP1-59481)

Learn more about PTMs related to PMCA4 Antibody (NBP1-59481).

Blogs on PMCA4

There are no specific blogs for PMCA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMCA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP2B4
Uniprot