PLEKHG7 Antibody

Images

 
Immunohistochemistry-Paraffin: PLEKHG7 Antibody [NBP2-32558] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHG7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IKEGGSCTVLDQPIPLDRLVVKSIEPLHVSVFGLRNAFLIQHENRYRQCIAAFLLQAQTENIKKTWMAQITTAISCFTKSQETKKI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLEKHG7 Protein (NBP2-32558PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHG7 Antibody

  • PH Domain-Containing Family G Member 7
  • Pleckstrin Homology Domain Containing, Family G (With RhoGef Domain) Member 7
  • Pleckstrin Homology Domain-Containing Family G Member 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00001848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-84425
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-85040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83867
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for PLEKHG7 Antibody (NBP2-32558) (0)

There are no publications for PLEKHG7 Antibody (NBP2-32558).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHG7 Antibody (NBP2-32558) (0)

There are no reviews for PLEKHG7 Antibody (NBP2-32558). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PLEKHG7 Antibody (NBP2-32558) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHG7 Products

PLEKHG7 NBP2-32558

Diseases for PLEKHG7 Antibody (NBP2-32558)

Discover more about diseases related to PLEKHG7 Antibody (NBP2-32558).

Blogs on PLEKHG7

There are no specific blogs for PLEKHG7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHG7 Antibody and receive a gift card or discount.