PLEKHG5 Antibody

Images

 
Western Blot: PLEKHG5 Antibody [NBP2-13774] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: PLEKHG5 Antibody [NBP2-13774] - Staining of human cell line U-2 OS shows localization to nucleus.
Immunohistochemistry-Paraffin: PLEKHG5 Antibody [NBP2-13774] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHG5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKK SLGEVLLPVFERKGIALGKVDIYLDQSNTPLSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHG5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLEKHG5 Protein (NBP2-13774PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHG5 Antibody

  • CMTRIC
  • DSMA4
  • GEF720
  • KIAA0720Guanine nucleotide exchange factor 720
  • NFkB activating protein
  • novel PH domain-containing protein
  • PH domain-containing family G member 5
  • pleckstrin homology domain containing family G member 5
  • pleckstrin homology domain containing, family G (with RhoGef domain) member 5
  • pleckstrin homology domain-containing family G member 5
  • Syx
  • Tech

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
H00154796-B01P
Species: Hu, Rt
Applications: WB, ELISA
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
MAB6618
Species: Hu, Mu
Applications: WB
NBP1-32311
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-58844
Species: Hu
Applications: ICC/IF
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03000
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-85130
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13774
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLEKHG5 Antibody (NBP2-13774) (0)

There are no publications for PLEKHG5 Antibody (NBP2-13774).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHG5 Antibody (NBP2-13774) (0)

There are no reviews for PLEKHG5 Antibody (NBP2-13774). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLEKHG5 Antibody (NBP2-13774) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHG5 Products

Bioinformatics Tool for PLEKHG5 Antibody (NBP2-13774)

Discover related pathways, diseases and genes to PLEKHG5 Antibody (NBP2-13774). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHG5 Antibody (NBP2-13774)

Discover more about diseases related to PLEKHG5 Antibody (NBP2-13774).
 

Pathways for PLEKHG5 Antibody (NBP2-13774)

View related products by pathway.

PTMs for PLEKHG5 Antibody (NBP2-13774)

Learn more about PTMs related to PLEKHG5 Antibody (NBP2-13774).
 

Research Areas for PLEKHG5 Antibody (NBP2-13774)

Find related products by research area.

Blogs on PLEKHG5

There are no specific blogs for PLEKHG5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHG5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHG5