PLEKHG5 Antibody - BSA Free

Western Blot: PLEKHG5 Antibody [NBP2-13774] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunocytochemistry/Immunofluorescence: PLEKHG5 Antibody [NBP2-13774] - Staining of human cell line U-2 OS shows localization to nucleus.

Immunohistochemistry-Paraffin: PLEKHG5 Antibody [NBP2-13774] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal and glial cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLEKHG5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLEKHG5 Antibody - BSA Free (NBP2-13774) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KGDRKSTGLKLSKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKGIALGKVDIYLDQSNTPLSL
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLEKHG5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PLEKHG5 Protein (NBP2-13774PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PLEKHG5 Antibody - BSA Free

• CMTRIC
• DSMA4
• GEF720
• KIAA0720Guanine nucleotide exchange factor 720
• NFkB activating protein
• novel PH domain-containing protein
• PH domain-containing family G member 5
• pleckstrin homology domain containing family G member 5
• pleckstrin homology domain containing, family G (with RhoGef domain) member 5
• pleckstrin homology domain-containing family G member 5
• Syx
• Tech

Background

PLEKHG5 encodes a protein that activates the nuclear factor kappa B (NFKB1) signaling pathway. Multations in this gene have been found in a family with distal spinal muscular atrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLEKHG5