Recombinant Human Plectin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Plectin Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 4384 - 4493 of Human PLEC1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLEC
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Plectin Protein

  • EBS1
  • HD1
  • Hemidesmosomal protein 1
  • LGMD2Q
  • PCNplectin 1, intermediate filament binding protein, 500kD
  • PLEC1b
  • PLEC1EBSO
  • plectin 1, intermediate filament binding protein 500kDa
  • plectin
  • plectin-1
  • PLTNepidermolysis bullosa simplex 1 (Ogna)

Background

PLEC1 - plectin 1, intermediate filament binding protein 500kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for Plectin Partial Recombinant Protein (H00005339-Q01) (0)

There are no publications for Plectin Partial Recombinant Protein (H00005339-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plectin Partial Recombinant Protein (H00005339-Q01) (0)

There are no reviews for Plectin Partial Recombinant Protein (H00005339-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plectin Partial Recombinant Protein (H00005339-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plectin Products

Bioinformatics Tool for Plectin Partial Recombinant Protein (H00005339-Q01)

Discover related pathways, diseases and genes to Plectin Partial Recombinant Protein (H00005339-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plectin Partial Recombinant Protein (H00005339-Q01)

Discover more about diseases related to Plectin Partial Recombinant Protein (H00005339-Q01).
 

Pathways for Plectin Partial Recombinant Protein (H00005339-Q01)

View related products by pathway.

PTMs for Plectin Partial Recombinant Protein (H00005339-Q01)

Learn more about PTMs related to Plectin Partial Recombinant Protein (H00005339-Q01).

Blogs on Plectin

There are no specific blogs for Plectin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Plectin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEC