Plectin Antibody (4C3)

Images

 
Immunocytochemistry/ Immunofluorescence: Plectin Antibody (4C3) [H00005339-M03] - Analysis of monoclonal antibody to PLEC1 on HeLa cell. Antibody concentration 15 ug/ml
ELISA: Plectin Antibody (4C3) [H00005339-M03] - Detection limit for recombinant GST tagged PLEC1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Plectin Antibody (4C3) Summary

Immunogen
PLEC1 (NP_000436 4384 a.a. - 4493 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLEC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Plectin Antibody (4C3)

  • EBS1
  • HD1
  • Hemidesmosomal protein 1
  • LGMD2Q
  • PCNplectin 1, intermediate filament binding protein, 500kD
  • PLEC1b
  • PLEC1EBSO
  • plectin 1, intermediate filament binding protein 500kDa
  • plectin
  • plectin-1
  • PLTNepidermolysis bullosa simplex 1 (Ogna)

Background

Plectin, a 500-kDa intermediate filament binding protein, is localized to the cytoplasm and acts to both stabilize and give strength to cells via cross-linking (1). Plectin cross-links intermediate filaments to microtubules and microfilaments, and anchors intermediate filaments to the plasma and nuclear membranes (2,3). Plectin binds many proteins, including actin, vimentin, and Lamin B. Phosphorylation by PKA or PKC results in decreased binding to Lamin B, and phosphorylation by PKA enhances the plectin-vimentin interactions (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91800
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-19775
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for Plectin Antibody (H00005339-M03) (0)

There are no publications for Plectin Antibody (H00005339-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plectin Antibody (H00005339-M03) (0)

There are no reviews for Plectin Antibody (H00005339-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Plectin Antibody (H00005339-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plectin Products

Bioinformatics Tool for Plectin Antibody (H00005339-M03)

Discover related pathways, diseases and genes to Plectin Antibody (H00005339-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plectin Antibody (H00005339-M03)

Discover more about diseases related to Plectin Antibody (H00005339-M03).
 

Pathways for Plectin Antibody (H00005339-M03)

View related products by pathway.

PTMs for Plectin Antibody (H00005339-M03)

Learn more about PTMs related to Plectin Antibody (H00005339-M03).

Blogs on Plectin

There are no specific blogs for Plectin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plectin Antibody (4C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEC
Uniprot