Recombinant Human Pleckstrin-2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Pleckstrin-2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human PLEK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITCPCLEYENRPLLIKLKTQTSTEYFLEACSREERDAWAFEIT

Protein/Peptide Type
Partial Recombinant Protein
Gene
PLEK2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pleckstrin-2 Protein

  • pleckstrin 2 homolog
  • pleckstrin 2
  • pleckstrin-2

Background

PLEK2 - pleckstrin 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBL1-07321
Species: Hu
MAB6967
Species: Hu
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF7109
Species: Mu
Applications: WB, IHC
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-06661
Species: Hu
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF446
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01) (0)

There are no publications for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01) (0)

There are no reviews for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pleckstrin-2 Products

Bioinformatics Tool for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01)

Discover related pathways, diseases and genes to Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01)

Discover more about diseases related to Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01).
 

Pathways for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01)

View related products by pathway.

PTMs for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01)

Learn more about PTMs related to Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01).
 

Research Areas for Pleckstrin-2 Partial Recombinant Protein (H00026499-Q01)

Find related products by research area.

Blogs on Pleckstrin-2

There are no specific blogs for Pleckstrin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pleckstrin-2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEK2