PLEC1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCE1. Source: E. coli
Amino Acid Sequence: MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PLCE1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92275. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PLEC1 Recombinant Protein Antigen
Background
The PLEC1 gene (also known as the PLEC gene) encodes a plectin protein that exists in nine isoforms: isoform 1 is 4,684 amino acids long at 531 kDA; isoform 2 is 4,574 amino acids long at 518 kDA; isoform 3 is 4,570 amino acids long at 518 kDA; isoform 4 is 4,547 amino acids long at 516 kDA; isoform 5 is 4,547 amino acids long at 516 kDA; isoform 6 is 4,551 amino acids long at 516 kDA; isoform 7 is 4,515 amino acids long at 512 kDA; isoform 8 is 4,525 amino acids long at 513 kDA; and isoform 9 is 4,533 amino acids long at 514 kDA. The PLEC1 gene functions as a structural component of muscle as links intermediate filaments with microtubules and microfilaments. It anchors the intermediate filaments to desmosomes or hemidesmosomes. Additionally, it is thought to have the ability to bind muscle proteins, like actin, to membrane complexes in the muscle. PLEC1 participates in cytoskeletal signaling, cytoskeleton remodeling of neurofilaments and keratin filaments, EGFR1 signaling pathways, apoptosis, collagen formation, and Alpha6-Beta4 integrin signaling pathways. It is known to interact with genes SRRM2, SQSTM1, GRB2, ITGB4, and RANBP2. Defects in this gene lead to epidermolysis bullosa simplex with pyloric atresia (EBS-PA), epidermolysis bullosa simplex with muscular dystrophy (MD-EBS), epidermolysis bullosa simplex Ogna type (O-EBS) and limb-girdle muscular dystrophy type 2Q (LGMD2Q). PLEC1 is also associated with myopathy, neuropathy, alexander disease, myasthenic syndrome, squamous cell carcinoma, epithelial ovarian cancer, and muscular dystrophy.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, mIF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P
Species: Ch, Hu, Rt
Applications: ICC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: AC
Publications for PLEC1 Protein (NBP1-92275PEP) (0)
There are no publications for PLEC1 Protein (NBP1-92275PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLEC1 Protein (NBP1-92275PEP) (0)
There are no reviews for PLEC1 Protein (NBP1-92275PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PLEC1 Protein (NBP1-92275PEP) (0)
Additional PLEC1 Products
Research Areas for PLEC1 Protein (NBP1-92275PEP)
Find related products by research area.
|
Blogs on PLEC1