PLCXD1 Antibody - Azide and BSA Free

Western Blot: PLCXD1 Antibody [H00055344-B01P] - Analysis of PLCXD1 expression in transfected 293T cell line by PLCXD1 polyclonal antibody. Lane 1: PLCXD1 transfected lysate(35.53 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PLCXD1 Antibody [H00055344-B01P] - Analysis of purified antibody to PLCXD1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PLCXD1 Antibody - Azide and BSA Free Summary

• Immunogen: PLCXD1 (NP_060860.1, 1 a.a. - 323 a.a.) full-length human protein. MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWLERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC
• Specificity: PLCXD1 - phosphatidylinositol-specific phospholipase C, X domain containing 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PLCXD1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLCXD1 Antibody - Azide and BSA Free

• FLJ11323
• phosphatidylinositol-specific phospholipase C, X domain containing 1
• PI-PLC X domain-containing protein 1

Background

Phospholipases are a group of enzymes that hydrolyze phospholipids into fatty acids and other lipophilic molecules. PLC is subdivided into beta, gamma, delta, epsilon, zeta and eta subtypes, which catalyze the hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) to inositol 1,4,5-trisphosphate (IP3) and 1,2-diacylglycerol (DAG). IP3 and DAG both have important second messenger functions. PLC-beta is primarily activated by Gq/11 proteins and PLC-gamma is activated by phosphorylation in response to a variety of growth factor and immune system signals. Phospholipases are ubiquitously expressed and have diverse biological functions including roles in inflammation, cell growth, signaling and death and maintenance of membrane phospholipids.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLCXD1
• Entrez:
  • 55344(Human)
• Uniprot:
  • NP_060860.1(Human)