Recombinant Human PLCD4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLCD4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 18 - 127 of Human PLCD4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVT

Protein/Peptide Type
Partial Recombinant Protein
Gene
PLCD4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLCD4 Protein

  • EC 3.1.4.11
  • hPLCD4
  • MGC12837
  • Phosphoinositide phospholipase C-delta-4
  • phospholipase C, delta 4
  • Phospholipase C-delta-4
  • PLC delta4
  • PLC-delta-4,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4

Background

PLCD4 - phospholipase C, delta 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2364
Species: Hu
Applications: WB, IHC
NBP2-19810
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF5315
Species: Hu, Mu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1396
Species: Hu
Applications: WB
H00085329-T01
Species: Hu
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-58719
Species: Hu
Applications: WB, ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00084812-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PLCD4 Partial Recombinant Protein (H00084812-Q01) (0)

There are no publications for PLCD4 Partial Recombinant Protein (H00084812-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLCD4 Partial Recombinant Protein (H00084812-Q01) (0)

There are no reviews for PLCD4 Partial Recombinant Protein (H00084812-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLCD4 Partial Recombinant Protein (H00084812-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLCD4 Products

Bioinformatics Tool for PLCD4 Partial Recombinant Protein (H00084812-Q01)

Discover related pathways, diseases and genes to PLCD4 Partial Recombinant Protein (H00084812-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLCD4 Partial Recombinant Protein (H00084812-Q01)

Discover more about diseases related to PLCD4 Partial Recombinant Protein (H00084812-Q01).
 

Pathways for PLCD4 Partial Recombinant Protein (H00084812-Q01)

View related products by pathway.

Research Areas for PLCD4 Partial Recombinant Protein (H00084812-Q01)

Find related products by research area.

Blogs on PLCD4

There are no specific blogs for PLCD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PLCD4 Antibody
NBP2-38393

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLCD4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCD4