PLC-gamma 2 Recombinant Protein Antigen

Images

 
There are currently no images for PLC-gamma 2 Protein (NBP1-87558PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PLC-gamma 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCG2.

Source: E. coli

Amino Acid Sequence: TKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLCG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87558.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLC-gamma 2 Recombinant Protein Antigen

  • EC 3.1.4.11
  • Phosphoinositide phospholipase C-gamma-2
  • phospholipase C gamma 2
  • phospholipase C, gamma 2 (phosphatidylinositol-specific)
  • phospholipase C, gamma 2 (phosphatidylyinositol-specific)
  • Phospholipase C-gamma-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2
  • Phospholipase C-IV
  • PLCG2
  • PLCgamma 2
  • PLC-gamma 2
  • PLC-gamma-2
  • PLC-IV

Background

Enzymes of the phospholipase C family catalyze the hydrolysis of phospholipids to yield diacylglycerols and water-soluble phosphorylated derivatives of the lipid head groups. The phospholipase C gamma-2 (PLCgammaII) is an enzyme that plays a crucial role in intracellular signal transduction pathways. This enzyme is important because of its role in the generation of second messengers following the hydrolysis of phosphatidylinositol 4,5-bisphosphate (1). PLCgammaII has been implicated in collagen-induced signal transduction in platelets and antigen-dependent signaling in B-lymphocytes. It has been suggested that tyrosine kinases activate PLCgammaII (2). It has also been shown that PLCgammaII was required for receptor activator of NF-kappaB ligand-induced (RANKL-induced) osteoclastogenesis by differentially regulating nuclear factor of activated T cells c1 (NFATc1), activator protein-1 (AP1), and NF-kappaB (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52533
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF2364
Species: Hu
Applications: IHC, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-78295
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-44995
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF3627
Species: Hu
Applications: WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP1-52176
Species: Mu
Applications: Flow, ICC/IF, PEP-ELISA
AF3767
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85313
Species: Hu
Applications: IHC,  IHC-P, WB
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
NB100-78039
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-87558PEP
Species: Hu
Applications: AC

Publications for PLC-gamma 2 Protein (NBP1-87558PEP) (0)

There are no publications for PLC-gamma 2 Protein (NBP1-87558PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLC-gamma 2 Protein (NBP1-87558PEP) (0)

There are no reviews for PLC-gamma 2 Protein (NBP1-87558PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLC-gamma 2 Protein (NBP1-87558PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLC-gamma 2 Products

Research Areas for PLC-gamma 2 Protein (NBP1-87558PEP)

Find related products by research area.

Blogs on PLC-gamma 2

There are no specific blogs for PLC-gamma 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLC-gamma 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCG2