PLC-beta 1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit PLC-beta 1 Antibody - BSA Free (NBP2-93680) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 917-1216 of human PLCB1 (NP_056007.1). KSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLCB1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PLC-beta 1 Antibody - BSA Free
Background
Phospholipase C beta 1 is encoded by this gene catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. This gene is activated by two G-protein alpha subunits, alpha-q and alpha-11. Two transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu
Applications: IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for PLC-beta 1 Antibody (NBP2-93680) (0)
There are no publications for PLC-beta 1 Antibody (NBP2-93680).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLC-beta 1 Antibody (NBP2-93680) (0)
There are no reviews for PLC-beta 1 Antibody (NBP2-93680).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PLC-beta 1 Antibody (NBP2-93680) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PLC-beta 1 Products
Research Areas for PLC-beta 1 Antibody (NBP2-93680)
Find related products by research area.
|
Blogs on PLC-beta 1