Recombinant Human Plakophilin-3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Plakophilin-3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 225-324 of Human PKP3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGFNSYGSHRTLQRLSSGFDDIDLPSA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PKP3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Plakophilin-3 Protein

  • plakophilin 3
  • plakophilin-3

Background

This gene encodes a member of the arm-repeat (armadillo) and plakophilin gene families. Plakophilin proteins contain numerous armadillo repeats, localize to cell desmosomes and nuclei, and participate in linking cadherins to intermediate filaments in the cytoskeleton. This protein may act in cellular desmosome-dependent adhesion and signaling pathways. PKP3( NP_009114, 225 a.a. - 325 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-05987
Species: Hu, Mu, Rt
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
46780002
Species: Hu
Applications: ELISA
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88099
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC

Publications for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01) (0)

There are no publications for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01) (0)

There are no reviews for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plakophilin-3 Products

Bioinformatics Tool for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01)

Discover related pathways, diseases and genes to Plakophilin-3 Partial Recombinant Protein (H00011187-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01)

Discover more about diseases related to Plakophilin-3 Partial Recombinant Protein (H00011187-Q01).
 

Pathways for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01)

View related products by pathway.

PTMs for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01)

Learn more about PTMs related to Plakophilin-3 Partial Recombinant Protein (H00011187-Q01).

Blogs on Plakophilin-3

There are no specific blogs for Plakophilin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ZEB1 Antibody
NBP1-05987
DRP1 Antibody
NB110-55288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Plakophilin-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PKP3