Recombinant Human Plakophilin-3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Plakophilin-3 Protein Summary

Description
Plakophilin-3 (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGFNSYGSHRTLQRLSSGFDDIDLPSA
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
PKP3

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Plakophilin-3 Protein

  • plakophilin 3
  • plakophilin-3

Background

This gene encodes a member of the arm-repeat (armadillo) and plakophilin gene families. Plakophilin proteins contain numerous armadillo repeats, localize to cell desmosomes and nuclei, and participate in linking cadherins to intermediate filaments in the cytoskeleton. This protein may act in cellular desmosome-dependent adhesion and signaling pathways. PKP3( NP_009114, 225 a.a. - 325 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9080
Species: Hu
Applications: WB
NBP2-45646
Species: Hu, Ca
Applications: WB, IHC
AF7265
Species: Mu
Applications: WB, IHC
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-05987
Species: Hu, Mu
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-91612
Species: Mu
Applications: WB
NBP1-46853
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88099
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8998
Species: Mu
Applications: Flow, CyTOF-reported
NBP1-67517
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP

Publications for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01) (0)

There are no publications for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01) (0)

There are no reviews for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human Plakophilin-3 Protein Products

Related Products by Gene

Bioinformatics Tool for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01)

Discover related pathways, diseases and genes to Plakophilin-3 Partial Recombinant Protein (H00011187-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01)

Discover more about diseases related to Plakophilin-3 Partial Recombinant Protein (H00011187-Q01).
 

Pathways for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01)

View related products by pathway.

PTMs for Plakophilin-3 Partial Recombinant Protein (H00011187-Q01)

Learn more about PTMs related to Plakophilin-3 Partial Recombinant Protein (H00011187-Q01).

Blogs on Plakophilin-3

There are no specific blogs for Plakophilin-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our Recombinant Human Plakophilin-3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PKP3

Customers Who Bought This Also Bought

ZEB1 Antibody
NBP1-05987
ZEB1 Antibody
NBP1-05987
ZEB1 Antibody
NBP1-05987