PLAC8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PLAC8 Antibody [NBP2-58850] - Staining of human cell line A-431 shows localization to cytosol.

Product Discontinued

PLAC8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLAC8 Antibody - BSA Free (NBP2-58850) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('MNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF',)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLAC8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 84%, Rat 86%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PLAC8 Antibody - BSA Free

• placenta-specific 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLAC8