PKR Recombinant Protein Antigen

Images

 
There are currently no images for PKR Recombinant Protein Antigen (NBP1-84878PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PKR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF2AK2.

Source: E. coli

Amino Acid Sequence: EFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF2AK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84878.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKR Recombinant Protein Antigen

  • double stranded RNA activated protein kinase
  • EC 2.7.11.1
  • eIF-2A protein kinase 2
  • EIF2AK1
  • EIF2AK2
  • eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase
  • interferon-induced, double-stranded RNA-activated protein kinase
  • interferon-inducible double stranded RNA dependent
  • interferon-inducible elF2alpha kinase
  • Interferon-inducible RNA-dependent protein kinase
  • P68 Kinase
  • PKR
  • PKRp68 kinase
  • PPP1R83
  • PRKR
  • PRKRMGC126524
  • Protein Kinase R
  • Protein kinase RNA-activated

Background

The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. The encoded protein plays an important role in the innate immune response against multiple DNA and RNA viruses.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-351
Species: Ha, Hu, Mu(-), Pm, Rt(-)
Applications: ELISA, IHC,  IHC-P, KO, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-02669
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF3999
Species: Hu
Applications: KO, WB
AF7946
Species: Hu
Applications: ICC, IHC, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
H00008575-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
AF2894
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
8499-IF
Species: Hu
Applications: BA
485-MI
Species: Mu
Applications: BA
NBP2-48704
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
AF7605
Species: Hu
Applications: WB
NBP1-90242
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for PKR Recombinant Protein Antigen (NBP1-84878PEP) (0)

There are no publications for PKR Recombinant Protein Antigen (NBP1-84878PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKR Recombinant Protein Antigen (NBP1-84878PEP) (0)

There are no reviews for PKR Recombinant Protein Antigen (NBP1-84878PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKR Recombinant Protein Antigen (NBP1-84878PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKR Products

Research Areas for PKR Recombinant Protein Antigen (NBP1-84878PEP)

Find related products by research area.

Blogs on PKR.

eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni...  Read full blog post.

PKR - Mediating cellular stress responses through multiple signaling pathways
Protein kinase R (PKR) is an intracellular stress-sensing protein that is able to detect and respond to viral infections. While PKR is able to sense and respond to a variety of signals, dsRNA is a well-characterized ligand. dsRNA produced during v...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2AK2