Recombinant Human PKR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PKR Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human EIF2AK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF2AK2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PKR Protein

  • double stranded RNA activated protein kinase
  • EC 2.7.11.1
  • eIF-2A protein kinase 2
  • EIF2AK1
  • EIF2AK2
  • eukaryotic translation initiation factor 2-alpha kinase 2P1/eIF-2A protein kinase
  • interferon-induced, double-stranded RNA-activated protein kinase
  • interferon-inducible double stranded RNA dependent
  • interferon-inducible elF2alpha kinase
  • Interferon-inducible RNA-dependent protein kinase
  • P68 Kinase
  • PKR
  • PKRp68 kinase
  • PPP1R83
  • PRKR
  • PRKRMGC126524
  • Protein Kinase R
  • Protein kinase RNA-activated

Background

EIF2AK2 - eukaryotic translation initiation factor 2-alpha kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-351
Species: Hu, Ha, Pm, Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-02669
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-47859
Species: Hu, Mu, Mk
Applications: WB, ICC/IF
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-48704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
AF4715
Species: Mu
Applications: WB
NBP2-38126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005610-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PKR Partial Recombinant Protein (H00005610-Q01) (0)

There are no publications for PKR Partial Recombinant Protein (H00005610-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKR Partial Recombinant Protein (H00005610-Q01) (0)

There are no reviews for PKR Partial Recombinant Protein (H00005610-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PKR Partial Recombinant Protein (H00005610-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKR Products

Bioinformatics Tool for PKR Partial Recombinant Protein (H00005610-Q01)

Discover related pathways, diseases and genes to PKR Partial Recombinant Protein (H00005610-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKR Partial Recombinant Protein (H00005610-Q01)

Discover more about diseases related to PKR Partial Recombinant Protein (H00005610-Q01).
 

Pathways for PKR Partial Recombinant Protein (H00005610-Q01)

View related products by pathway.

PTMs for PKR Partial Recombinant Protein (H00005610-Q01)

Learn more about PTMs related to PKR Partial Recombinant Protein (H00005610-Q01).
 

Research Areas for PKR Partial Recombinant Protein (H00005610-Q01)

Find related products by research area.

Blogs on PKR.

eIF2alpha - a regulator of global translation in response to cellular stress
Eukaryotic initiation factor 2 (eIF2) regulates global protein translation by binding to Met-tRNA and the 40S ribosome to form the pre-initiation complex. eIF2 is a heterotrimer consisting of alpha, beta, and gamma subunits. The 36kDA eIF2a subuni...  Read full blog post.

PKR - Mediating cellular stress responses through multiple signaling pathways
Protein kinase R (PKR) is an intracellular stress-sensing protein that is able to detect and respond to viral infections. While PKR is able to sense and respond to a variety of signals, dsRNA is a well-characterized ligand. dsRNA produced during v...  Read full blog post.

Customers Who Bought This Also Bought

PKR Antibody
NBP1-77266

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PKR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF2AK2
Entrez