PKNOX2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PKNOX2 Antibody [NBP2-57402] - Staining of human cell line RH-30 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PKNOX2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MMQHASPAPALTMMATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQAQLEADKRAVYR
• Predicted Species: Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PKNOX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PKNOX2 Recombinant Protein Antigen (NBP2-57402PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PKNOX2 Antibody - BSA Free

• homeobox protein PKNOX2
• PBX/knFLJ13074
• PBX/knPREP2Homeobox protein PREP-2

Background

Homeodomain proteins are sequence-specific transcription factors that share a highly conserved DNA-binding domain andplay fundamental roles in cell proliferation, differentiation, and death. PKNOX2 belongs to the TALE (3-amino acidloop extension) class of homeodomain proteins characterized by a 3-amino acid extension between alpha helices 1 and 2within the homeodomain (Imoto et al., 2001 (PubMed 11549286)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PKNOX2