PKNOX2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PKNOX2 Antibody [NBP2-55463] - Staining of human cell line RH-30 shows localization to nucleus & cytokinetic bridge. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PKNOX2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LEKVNELCKDFCNRYITCLKTKMHSDNLLRNDLGGPYSPNQPSINLHSQDLLQNSPNSMSGVSNNPQGIVVPASALQQGNIAMTTVNSQVVSGGA
Specificity
Specificity of human PKNOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PKNOX2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PKNOX2 Antibody

  • homeobox protein PKNOX2
  • PBX/knFLJ13074
  • PBX/knPREP2Homeobox protein PREP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81728
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13734
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NBP2-31853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74638
Species: Hu
Applications: WB (-), ICC/IF, IP
H00003886-P01
Species: Hu
H00003882-B01P
Species: Hu
Applications: WB
NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
AF6318
Species: Hu
Applications: ICC
NBP1-86057
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03933
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF6175
Species: Hu
Applications: WB, ICC
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NBP2-55463
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for PKNOX2 Antibody (NBP2-55463) (0)

There are no publications for PKNOX2 Antibody (NBP2-55463).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKNOX2 Antibody (NBP2-55463) (0)

There are no reviews for PKNOX2 Antibody (NBP2-55463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PKNOX2 Antibody (NBP2-55463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PKNOX2 Products

Bioinformatics Tool for PKNOX2 Antibody (NBP2-55463)

Discover related pathways, diseases and genes to PKNOX2 Antibody (NBP2-55463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PKNOX2 Antibody (NBP2-55463)

Discover more about diseases related to PKNOX2 Antibody (NBP2-55463).
 

Pathways for PKNOX2 Antibody (NBP2-55463)

View related products by pathway.

PTMs for PKNOX2 Antibody (NBP2-55463)

Learn more about PTMs related to PKNOX2 Antibody (NBP2-55463).

Blogs on PKNOX2

There are no specific blogs for PKNOX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PKNOX2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PKNOX2