PIK4CA Antibody - BSA Free

Western Blot: PIK4CA Antibody [NBP3-35900] - Western blot analysis of various lysates using PIK4CA Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: PIK4CA Antibody [NBP3-35900] - Immunofluorescence analysis of L929 cells using PIK4CA Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PIK4CA Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1780-1860 of human PIK4CA (P42356).
  
  Sequence:
  PEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDML
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PI4KA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 237 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for PIK4CA Antibody - BSA Free

• EC 2.7.1.67
• FLJ16556
• phosphatidylinositol 4-kinase alpha
• phosphatidylinositol 4-kinase, catalytic, alpha
• phosphatidylinositol 4-kinase, type III, alpha
• pi4K230
• PI4KA
• PI4K-alpha
• PI4-kinase alpha
• PIK4
• PIK4CA
• PIK4CAphosphatidylinositol 4-kinase 230
• PtdIns-4-kinase alpha

Background

Phosphatidylinositol 4 kinase III alpha encodes a phosphatidylinositol (PI) 4-kinase which catalyzes the first committed step in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. The mammalian PI 4-kinases have been classified into two types, II and III, based on their molecular mass, and modulation by detergent and adenosine. The protein encoded by this gene is a type III enzyme that is not inhibited by adenosine. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PI4KA