PIGZ Antibody


Western Blot: PIGZ Antibody [NBP1-69251] - This Anti-PIGZ antibody was used in Western Blot of Hela tissue lysate at a concentration of 1ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Bv, Eq, GP, Rb, YeSpecies Glossary
Applications WB

Order Details

PIGZ Antibody Summary

Synthetic peptides corresponding to PIGZ(phosphatidylinositol glycan anchor biosynthesis, class Z) The peptide sequence was selected from the N terminal of PIGZ. Peptide sequence VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PIGZ and was validated on Western blot.
Theoretical MW
63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PIGZ Antibody

  • class Z
  • EC 2.4.1
  • EC 2.4.1.-
  • FLJ12768
  • GPI mannosyltransferase 4
  • GPI mannosyltransferase IV
  • hSMP3
  • phosphatidylinositol glycan anchor biosynthesis, class Z
  • Phosphatidylinositol-glycan biosynthesis class Z protein
  • PIG-Z
  • SMP3 mannosyltransferase
  • SMP3SMP3 homolog


The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Eq, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb, Ze
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Rb
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Eq, GP, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt, ChHa
Applications: WB, Simple Western, IHC, IHC-P

Publications for PIGZ Antibody (NBP1-69251) (0)

There are no publications for PIGZ Antibody (NBP1-69251).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGZ Antibody (NBP1-69251) (0)

There are no reviews for PIGZ Antibody (NBP1-69251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGZ Antibody (NBP1-69251) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PIGZ Products

Bioinformatics Tool for PIGZ Antibody (NBP1-69251)

Discover related pathways, diseases and genes to PIGZ Antibody (NBP1-69251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGZ Antibody (NBP1-69251)

Discover more about diseases related to PIGZ Antibody (NBP1-69251).

Blogs on PIGZ

There are no specific blogs for PIGZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIGZ Antibody and receive a gift card or discount.


Gene Symbol PIGZ