PIGH Antibody (2F8)

Images

 
Western Blot: PIGH Antibody (2F8) [H00005283-M01] - Analysis of PIGH expression in transfected 293T cell line by PIGH monoclonal antibody (M01), clone 2F8.Lane 1: PIGH transfected lysate (Predicted MW: 21.1 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PIGH Antibody (2F8) Summary

Immunogen
PIGH (NP_004560, 89 a.a. - 188 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP
Specificity
PIGH - phosphatidylinositol glycan, class H (2F8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PIGH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PIGH Antibody (2F8)

  • EC 2.4.1.198
  • GPI-H
  • phosphatidylinositol glycan anchor biosynthesis, class H
  • phosphatidylinositol glycan, class H
  • phosphatidylinositol N-acetylglucosaminyltransferase subunit H
  • Phosphatidylinositol-glycan biosynthesis class H protein
  • phosphatidylinositol-glycan biosynthesis, class H protein
  • PIG-H

Background

This gene encodes an endoplasmic reticulum associated protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. The protein encoded by this gene is a subunit of the GPI N-acetylglucosaminyl (GlcNAc) transferase that transfers GlcNAc to phosphatidylinositol (PI) on the cytoplasmic side of the endoplasmic reticulum. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86283
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13760
Species: Hu
Applications: IHC, IHC-P
H00009091-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-38056
Species: Hu
Applications: IHC, IHC-P
NBP1-69261
Species: Hu
Applications: WB, IHC
NB500-330
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-76331
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB6967
Species: Hu
Applications: WB
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-85856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow

Publications for PIGH Antibody (H00005283-M01) (0)

There are no publications for PIGH Antibody (H00005283-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIGH Antibody (H00005283-M01) (0)

There are no reviews for PIGH Antibody (H00005283-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIGH Antibody (H00005283-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIGH Products

Bioinformatics Tool for PIGH Antibody (H00005283-M01)

Discover related pathways, diseases and genes to PIGH Antibody (H00005283-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGH Antibody (H00005283-M01)

Discover more about diseases related to PIGH Antibody (H00005283-M01).
 

Pathways for PIGH Antibody (H00005283-M01)

View related products by pathway.

Blogs on PIGH

There are no specific blogs for PIGH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIGH Antibody (2F8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIGH
Entrez
Uniprot