PIEZO1 Antibody

Images

 
Immunohistochemistry-Paraffin: PIEZO1 Antibody [NBP2-13758] - Staining of human lung shows moderate positivity in pneumocytes.
Immunohistochemistry-Paraffin: PIEZO1 Antibody [NBP2-13758] - Staining of human lung shows positivity in erythrocytes.
Immunohistochemistry-Paraffin: PIEZO1 Antibody [NBP2-13758] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.
Immunohistochemistry-Paraffin: PIEZO1 Antibody [NBP2-13758] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PIEZO1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFD PQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTAD ITLRFTWNFQRDLAKGGTVEYANEKH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIEZO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PIEZO1 Protein (NBP2-13758PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PIEZO1 Antibody

  • FAM38A
  • member A
  • membrane protein induced by beta-amyloid treatment
  • Mib
  • piezo-type mechanosensitive ion channel component 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF7305
Species: Hu, Mu, Rt
Applications: WB
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13758
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for PIEZO1 Antibody (NBP2-13758) (0)

There are no publications for PIEZO1 Antibody (NBP2-13758).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIEZO1 Antibody (NBP2-13758) (0)

There are no reviews for PIEZO1 Antibody (NBP2-13758). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PIEZO1 Antibody (NBP2-13758) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIEZO1 Products

Bioinformatics Tool for PIEZO1 Antibody (NBP2-13758)

Discover related pathways, diseases and genes to PIEZO1 Antibody (NBP2-13758). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIEZO1 Antibody (NBP2-13758)

Discover more about diseases related to PIEZO1 Antibody (NBP2-13758).
 

Pathways for PIEZO1 Antibody (NBP2-13758)

View related products by pathway.

Research Areas for PIEZO1 Antibody (NBP2-13758)

Find related products by research area.

Blogs on PIEZO1.

Touch Infographic: From Touch Receptors to the Brain
The body contains thousands of receptors and nerves which allow us to experience the sense of touch, also referred to as tactile perception. The somatosensory system allows organisms to perceive and decode a wide range of tactile stimuli to allow for...  Read full blog post.

PIEZO1: A Mechanosensitive Ion Channel Protein
PIEZO1, and its close homologue PIEZO2, are mechanosensitive ion channel proteins. Mechanosensitive ion channels couple protein conformation to the mechanics of the surrounding membrane, and switch between a closed state and an open state in response...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIEZO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIEZO1