PICK1 Antibody [Alexa Fluor® 350]

Images

 

Product Details

Summary
Product Discontinued
View other related PICK1 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-35510AF350
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

PICK1 Antibody [Alexa Fluor® 350] Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-400 of human PICK1 (NP_036539.1).

Sequence:
YLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFPI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PICK1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for PICK1 Antibody [Alexa Fluor® 350]

  • alpha binding protein
  • dJ1039K5
  • MGC15204
  • PICK
  • PRKCA-binding protein
  • PRKCABPprotein interacting with PRKCA
  • Protein interacting with C kinase 1
  • protein interacting with PRKCA 1
  • Protein kinase C-alpha-binding protein

Background

PSD-95/DLG/ZO-1 (PDZ) domain-containing proteins play a central role in synaptic membrane protein localization. The protein interacting with protein kinase C (PICK 1) is a synaptic PDZ domain protein that also contains a coiled-coil and acidic domain. Studies indicate that PICK 1 functions as a targeting and transport protein and has been shown to interact with protein kinase C alpha (PKC alpha), AMPA-type glutamate receptors, and several other membrane receptors via its PDZ domain. The interaction of PICK 1 with PKC alpha is highly dependent on the activation of the kinase. It appears that PICK 1 directs the activated form of PKC alpha to membrane anchored GluR2. Once phosphorylated by PKC alpha, GluR2 is released from the synaptic anchor proteins. Once released, GluR2 is transported from the synaptic membrane in a PICK 1-dependent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NLS892
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC,  IHC-P, WB
NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-76718
Species: Hu
Applications: ELISA
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-22409
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-14321
Species: Hu
Applications: IHC,  IHC-P, WB
AF2656
Species: Hu
Applications: IHC, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NLS921
Species: Bv, Hu
Applications: ICC, IHC,  IHC-P, WB
NBP2-22399
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB

Publications for PICK1 Antibody (NBP3-35510AF350) (0)

There are no publications for PICK1 Antibody (NBP3-35510AF350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PICK1 Antibody (NBP3-35510AF350) (0)

There are no reviews for PICK1 Antibody (NBP3-35510AF350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PICK1 Antibody (NBP3-35510AF350). (Showing 1 - 1 of 1 FAQ).

  1. Here is a difficult request. We are looking for an antibody with the following specifications: Anti-PICK1 Reactive in mouse without sodium azide, so it can be injected into the mouse without compromising its life With PBS (for example) It does not necessarily have to be guaranteed. Have you got anything like it?
    • Unfortunately all of our anti-PICK1 mouse-reactive antibodies are supplied in sodium azide. We do have anti human PICK1 without preservatives, but that would not be suitable if you are working with mouse samples. NB100-41403 contains only 0.02% sodium azide which is the lowest percentage. We also offer an Antibody Concentration and Clean Up Antibody Purification Kit which can be used to reduce the concentration of unwanted additives often found in antibody formulations, such as sodium azide, glycine or tris. This kit is offered in two sizes: cat# 861-0005 includes 1 column and cat# 861-0010 includes 3 columns.

Secondary Antibodies

 

Isotype Controls

Additional PICK1 Products

Research Areas for PICK1 Antibody (NBP3-35510AF350)

Find related products by research area.

Blogs on PICK1

There are no specific blogs for PICK1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PICK1 Antibody [Alexa Fluor® 350] and receive a gift card or discount.

Bioinformatics

Gene Symbol PICK1