PHOX2A Recombinant Protein Antigen

Images

 
There are currently no images for PHOX2A Recombinant Protein Antigen (NBP2-56644PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PHOX2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHOX2A.

Source: E. coli

Amino Acid Sequence: AAELLKAWQPAESGPGPFSGVLSSFHRKPGPALKTNLF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PHOX2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56644.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHOX2A Recombinant Protein Antigen

  • aristaless (Drosophila) homeobox, aristaless homeobox (Drosophila), fibrosis ofextraocular muscles, congenital, 2, autosomal recessive
  • aristaless homeobox homolog
  • Aristaless homeobox protein homolog
  • arix homeodomain protein
  • ARIX1 homeodomain protein
  • ARIXNCAM2
  • CFEOM2MGC52227
  • paired mesoderm homeobox protein 2A
  • paired-like homeobox 2apaired-like (aristaless) homeobox 2a
  • PMX2AFEOM2

Background

PHOX2A is encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF4940
Species: Hu, Mu
Applications: ICC
NBP2-37969
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
AF2567
Species: Mu
Applications: IHC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
AF3876
Species: Hu, Mu
Applications: IHC, WB
NBP2-46648
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NBP2-70411
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF482
Species: Mu
Applications: IHC, WB
NBP3-27888
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF,  IHC-P, WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-56644PEP
Species: Hu
Applications: AC

Publications for PHOX2A Recombinant Protein Antigen (NBP2-56644PEP) (0)

There are no publications for PHOX2A Recombinant Protein Antigen (NBP2-56644PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHOX2A Recombinant Protein Antigen (NBP2-56644PEP) (0)

There are no reviews for PHOX2A Recombinant Protein Antigen (NBP2-56644PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PHOX2A Recombinant Protein Antigen (NBP2-56644PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PHOX2A Products

Research Areas for PHOX2A Recombinant Protein Antigen (NBP2-56644PEP)

Find related products by research area.

Blogs on PHOX2A

There are no specific blogs for PHOX2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PHOX2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PHOX2A