Recombinant Human Phosphorylase B GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Phosphorylase B Protein [H00005257-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Phosphorylase B GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 984-1093 of Human Phosphorylase B

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQDKVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEGEVKPNNDDPCLIS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PHKB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Phosphorylase B GST (N-Term) Protein

  • DKFZp781E15103
  • FLJ41698
  • phosphorylase b kinase regulatory subunit beta
  • phosphorylase kinase beta-subunit
  • Phosphorylase kinase subunit beta
  • phosphorylase kinase, beta

Background

PHKB - phosphorylase kinase, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92264
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46393
Species: Hu, Mu
Applications: IHC, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87281
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87280
Species: Hu
Applications: IHC, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP1-86182
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-16689
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP1-90980
Species: Hu
Applications: IHC, IHC-P
AF3880
Species: Hu
Applications: ICC, WB

Publications for Phosphorylase B Partial Recombinant Protein (H00005257-Q01) (0)

There are no publications for Phosphorylase B Partial Recombinant Protein (H00005257-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phosphorylase B Partial Recombinant Protein (H00005257-Q01) (0)

There are no reviews for Phosphorylase B Partial Recombinant Protein (H00005257-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phosphorylase B Partial Recombinant Protein (H00005257-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Phosphorylase B Products

Bioinformatics Tool for Phosphorylase B Partial Recombinant Protein (H00005257-Q01)

Discover related pathways, diseases and genes to Phosphorylase B Partial Recombinant Protein (H00005257-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phosphorylase B Partial Recombinant Protein (H00005257-Q01)

Discover more about diseases related to Phosphorylase B Partial Recombinant Protein (H00005257-Q01).

Research Areas for Phosphorylase B Partial Recombinant Protein (H00005257-Q01)

Find related products by research area.

Blogs on Phosphorylase B

There are no specific blogs for Phosphorylase B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Phosphorylase B GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PHKB