Phospholipase A2 X Antibody

Images

 
Western Blot: Phospholipase A2 X Antibody [H00008399-B01P] - Analysis of PLA2G10 expression in transfected 293T cell line by PLA2G10 polyclonal antibody. Lane1:PLA2G10 transfected lysate(18.15 KDa). ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Phospholipase A2 X Antibody Summary

Immunogen
PLA2G10 (NP_003552.1, 1 a.a. - 165 a.a.) full-length human protein. MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PLA2G10
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Phospholipase A2 X Antibody

  • EC 3.1.1.4
  • group 10 secretory phospholipase A2
  • Group X secretory phospholipase A2
  • GX sPLA2
  • GXPLA2
  • GXSPLA2
  • MGC119918
  • MGC119919
  • MGC133367
  • Phosphatidylcholine 2-acylhydrolase 10
  • phospholipase A2, group X
  • SPLA2
  • sPLA2-X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: WB, IP
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84449
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
H00008399-B01P
Species: Hu
Applications: WB

Publications for Phospholipase A2 X Antibody (H00008399-B01P) (0)

There are no publications for Phospholipase A2 X Antibody (H00008399-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase A2 X Antibody (H00008399-B01P) (0)

There are no reviews for Phospholipase A2 X Antibody (H00008399-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phospholipase A2 X Antibody (H00008399-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Phospholipase A2 X Products

Bioinformatics Tool for Phospholipase A2 X Antibody (H00008399-B01P)

Discover related pathways, diseases and genes to Phospholipase A2 X Antibody (H00008399-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase A2 X Antibody (H00008399-B01P)

Discover more about diseases related to Phospholipase A2 X Antibody (H00008399-B01P).
 

Pathways for Phospholipase A2 X Antibody (H00008399-B01P)

View related products by pathway.

PTMs for Phospholipase A2 X Antibody (H00008399-B01P)

Learn more about PTMs related to Phospholipase A2 X Antibody (H00008399-B01P).
 

Research Areas for Phospholipase A2 X Antibody (H00008399-B01P)

Find related products by research area.

Blogs on Phospholipase A2 X

There are no specific blogs for Phospholipase A2 X, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholipase A2 X Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G10
Uniprot