Home » Phospholipase A2 X » Phospholipase A2 X Antibodies » Phospholipase A2 X Antibody (5G11)

Phospholipase A2 X Antibody (5G11)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Phospholipase A2 X Antibody (5G11) [H00008399-M01-100ug] - Detection against Immunogen (36.96 KDa).
Western Blot: Phospholipase A2 X Antibody (5G11) [H00008399-M01-100ug] - Detection against Immunogen (36.96 KDa).
Western Blot: Phospholipase A2 X Antibody (5G11) [H00008399-M01-100ug] - Analysis of PLA2G10 expression in transfected 293T cell line by PLA2G10 monoclonal antibody (M01), clone 5G11. Lane 1: PLA2G10 transfected lysate ...read more
ELISA: Phospholipase A2 X Antibody (5G11) [H00008399-M01-100ug] - Detection limit for recombinant GST tagged PLA2G10 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5G11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Phospholipase A2 X Antibody (5G11) Summary

Immunogen
PLA2G10 (NP_003552.1, 64 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLA2G10
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Phospholipase A2 X Antibody (5G11)

  • EC 3.1.1.4
  • group 10 secretory phospholipase A2
  • Group X secretory phospholipase A2
  • GX sPLA2
  • GXPLA2
  • GXSPLA2
  • MGC119918
  • MGC119919
  • MGC133367
  • Phosphatidylcholine 2-acylhydrolase 10
  • phospholipase A2, group X
  • SPLA2
  • sPLA2-X

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLA2G1B Antibody
(630823)
MAB5018
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 2 µg/mL of Human PLA2G1B Monoclonal Antibody (Catalog # MAB5018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for PLA2G1B at approximately 17 kDa (as indicated). This experiment was conducted under non-reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB, IP
PLA2G2A Antibody
[Unconjugated]
AF4925
Western blot shows lysates of mouse small intestine tissue. PVDF Membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for PLA2G2A at approximately 17 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PLA2G2A was detected in perfusion fixed frozen sections of mouse intestine using Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells in intestinal glands. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of mouse small intestine tissue, loaded at 0.2 mg/mL. A specific band was detected for PLA2G2A at approximately 27 kDa (as indicated) using 5 µg/mL of Sheep Anti-Mouse PLA2G2A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4925) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Species: Mu
Applications: WB, Simple Western, IHC
PLA2G6 Antibody
H00008398-D01P
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in mouse kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in human kidney.
Western Blot: PLA2G6 Antibody [H00008398-D01P] - Analysis of PLA2G6 expression in transfected 293T cell line by PLA2G6 polyclonal antibody.Lane 1: PLA2G6 transfected lysate(84.10 KDa).Lane 2: Non-transfected lysate.
Species: Hu, Mu
Applications: WB
PLA2G4A Antibody
NBP1-31344
Western Blot: PLA2G4A Antibody [NBP1-31344] - Sample (30 ug of whole cell lysate) A: Raji 7.5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: PLA2G4A Antibody [NBP1-31344] - Analysis of HeLa, using NBP1-31344 at 1:200 dilution.
Immunohistochemistry-Paraffin: PLA2G4A Antibody [NBP1-31344] - PLA2G4A antibody detects PLA2G4A protein at cytoplasm in mouse liver by immunohistochemical analysis. Sample: Paraffin-embedded mouse liver. PLA2G4A antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Phospholipase B1
Antibody
H00151056-B01P
Western Blot: Phospholipase B1 Antibody [H00151056-B01P] - Analysis of PLB1 expression in transfected 293T cell line by PLB1 polyclonal antibody. Lane 1: PLB1 transfected lysate(46.53 KDa). Lane 2: Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB
TIP60 Antibody
NBP2-24613
Western Blot: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in human brain lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse brain and 4) rat brain lysate using this antibody. 25 ug/ml.
Immunohistochemistry-Paraffin: TIP60 Antibody [NBP2-24613] - analysis of TIP60 in formalin-fixed, paraffin-embedded human brain tissue using an isotype control (top) and this antibody (bottom) at 5 ug/ml.
Simple Western: TIP60 Antibody [NBP2-24613] - Simple Western lane view shows a specific band for TIP60 in 0.2 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(1 Publication)
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Phospholipase A2
IID Antibody
NBP2-94062
Western Blot: Phospholipase A2 IID Antibody [NBP2-94062] - Analysis of extracts of various cell lines, using Phospholipase A2 IID at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: Phospholipase A2 IID Antibody [NBP2-94062] - Analysis of MCF7 cells using Phospholipase A2 IID. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Phospholipase A2 IID Antibody [NBP2-94062] - Paraffin-embedded mouse testis using Phospholipase A2 IID.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
14-3-3 zeta
Antibody (818515) [Un ...
MAB2669
Western blot shows lysates of SH‑SY5Y human neuroblastoma cell line,SK‑Mel‑28 human malignant melanoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and C6 rat glioma cell line. PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human14‑3‑3 zeta  Monoclonal Antibody (Catalog # MAB2669) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for14‑3‑3 zeta at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of SH‑SY5Y human neuroblastoma cell line, loaded at 0.5 mg/mL. A specific band was detected for 14‑3‑3 zeta at approximately 34 kDa (as indicated) using 2 µg/mL of Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
14‑3‑3 zeta  was detected in immersion fixed paraffin-embedded sections of human squamous cell carcinoma using Mouse Anti-Human 14‑3‑3 zeta Monoclonal Antibody (Catalog # MAB2669) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei and plasma membrane. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: WB, Simple Western, IHC
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).
Simple Western: COX-2 Antibody [NB100-689] - Simple Western lane view shows a specific band for COX2 in 1.0 mg/ml of Rat Brain at an antibody concentration of 1:100. This experiment was performed under reducing conditions using the 12-230 kDa separation system. Image provided through customer review.
(1 Review)
(29 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
TEF1 Antibody
NBP2-94035
Western Blot: TEF1 Antibody [NBP2-94035] - Analysis of extracts of various cell lines, using TEF1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 120s.
Immunocytochemistry/Immunofluorescence: TEF1 Antibody [NBP2-94035] - Analysis of extracts of HeLa cell line, using TEF1 rabbit IgG. The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
Immunohistochemistry-Paraffin: TEF1 Antibody [NBP2-94035] - Paraffin-embedded mouse lung using TEF1.
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
C-Reactive
Protein/CRP [HRP]
DCRP00
(3 Reviews)
(83 Publications)
Species: Hu
IL-6 [HRP]
D6050
(26 Reviews)
(474 Publications)
Species: Hu
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PLA2R1 Antibody
(12-6-5)
NBP2-50248
Western Blot: PLA2R1 Antibody (12-6-5) [NBP2-50248] - 1ug of recombinant full length extracellular domain of human PLA2R (NC8) and a N-terminus fragment of PLA2R (NC3) were subjected to SDS PAGE followed by western blot using Ms anti-PLAR (Cl12-6-5) at dilution 1:10000.
Immunocytochemistry/Immunofluorescence: PLA2R1 Antibody (12-6-5) [NBP2-50248] - Staining of PLA2R over-expressing podocytes revealing cell surface expression of the PLA2R receptor. Dilution 1:400 (under 40x lens).
Immunohistochemistry: PLA2R1 Antibody (12-6-5) [NBP2-50248] - Membranous nephropathy kidney showing staining of PLA2R in the capillary wall of the glomerular basement membrane. IHC Protocol Info: HIER pH8 (CC1) for 64 minutes, 36 minute primary antibody (PLA2R Mouse 12-6-5) incubation at room temperature using a dilution of 1:5000, using Ventana Ultraview DAB detection system.
(1 Publication)
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(18 Reviews)
(408 Publications)
Species: Hu
alpha-Sarcoglycan
Antibody (JA51-81)
NBP2-67150
Western Blot: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of alpha sarcoglycan on rat heart tissue lysates using anti-alpha sarcoglycan antibody at 1:500 dilution.
Immunohistochemistry-Frozen: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Human skeletal muscle tissue. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of paraffin-embedded mouse heart tissue using anti-alpha sarcoglycan antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Phospholipase A2 X
Antibody (5G11)
H00008399-M01-100ug
Phospholipase A2 X Antibody (5G11)
Species: Hu
Applications: WB, ELISA

Publications for Phospholipase A2 X Antibody (H00008399-M01-100ug) (0)

There are no publications for Phospholipase A2 X Antibody (H00008399-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase A2 X Antibody (H00008399-M01-100ug) (0)

There are no reviews for Phospholipase A2 X Antibody (H00008399-M01-100ug). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phospholipase A2 X Antibody (H00008399-M01-100ug) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Phospholipase A2 X Products

Bioinformatics Tool for Phospholipase A2 X Antibody (H00008399-M01-100ug)

Discover related pathways, diseases and genes to Phospholipase A2 X Antibody (H00008399-M01-100ug). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase A2 X Antibody (H00008399-M01-100ug)

Discover more about diseases related to Phospholipase A2 X Antibody (H00008399-M01-100ug).
 

Pathways for Phospholipase A2 X Antibody (H00008399-M01-100ug)

View related products by pathway.

PTMs for Phospholipase A2 X Antibody (H00008399-M01-100ug)

Learn more about PTMs related to Phospholipase A2 X Antibody (H00008399-M01-100ug).
 

Research Areas for Phospholipase A2 X Antibody (H00008399-M01-100ug)

Find related products by research area.

Blogs on Phospholipase A2 X

There are no specific blogs for Phospholipase A2 X, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Phospholipase A2 X Antibody (5G11) and receive a gift card or discount.


Bioinformatics

Gene Symbol PLA2G10
Entrez
OMIM
Uniprot