PHF20L1 Antibody

Immunocytochemistry/Immunofluorescence: PHF20L1 Antibody [NBP1-85655] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane.

Immunohistochemistry-Paraffin: PHF20L1 Antibody [NBP1-85655] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

PHF20L1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EETSTCIATPDVEKKEDLPTSSETFGLHVENVPKMVFPQPESTLSNKRKNNQGNSFQAKRARLNKITGLLASKAVGVDGAEKKEDYNETA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHF20L1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PHF20L1 Protein (NBP1-85655PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 24492612)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHF20L1 Antibody

• CGI-72
• FLJ13649
• FLJ21615
• MGC64923
• PHD finger protein 20-like 1
• PHD finger protein 20-like protein 1
• tudor domain-containing protein PHF20L1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHF20L1 Antibody (NBP1-85655)(1)

Publication using NBP1-85655

• Esteve PO, Terragni J, Deepti K et al. Methyllysine Reader Plant Homeodomain (PHD) Finger Protein 20-like 1 (PHF20L1) Antagonizes DNA (Cytosine-5) Methyltransferase 1 (DNMT1) Proteasomal Degradation. J Biol Chem 2014-03-21 [PMID: 24492612]

Bioinformatics

• Gene Symbol: PHF20L1