PHF20L1 Antibody

Images

 
Immunohistochemistry-Paraffin: PHF20L1 Antibody [NBP1-84501] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHF20L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLADVYGVTEVLHGLQLKIGILKNKHHPDLHLWACSGKRKDQDQIIAGVEKKIAQDTVNREEKKYVQNHKEPPRLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF20L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PHF20L1 Protein (NBP1-84501PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF20L1 Antibody

  • CGI-72
  • FLJ13649
  • FLJ21615
  • MGC64923
  • PHD finger protein 20-like 1
  • PHD finger protein 20-like protein 1
  • tudor domain-containing protein PHF20L1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80860
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92281
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79413
Species: Hu
Applications: WB
NBP1-21389
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-89951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-51599
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84123
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-13951
Species: Hu
Applications: IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6810
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84501
Species: Hu
Applications: IHC, IHC-P

Publications for PHF20L1 Antibody (NBP1-84501) (0)

There are no publications for PHF20L1 Antibody (NBP1-84501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF20L1 Antibody (NBP1-84501) (0)

There are no reviews for PHF20L1 Antibody (NBP1-84501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PHF20L1 Antibody (NBP1-84501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF20L1 Products

Bioinformatics Tool for PHF20L1 Antibody (NBP1-84501)

Discover related pathways, diseases and genes to PHF20L1 Antibody (NBP1-84501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF20L1 Antibody (NBP1-84501)

Discover more about diseases related to PHF20L1 Antibody (NBP1-84501).
 

Pathways for PHF20L1 Antibody (NBP1-84501)

View related products by pathway.

PTMs for PHF20L1 Antibody (NBP1-84501)

Learn more about PTMs related to PHF20L1 Antibody (NBP1-84501).

Blogs on PHF20L1

There are no specific blogs for PHF20L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF20L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF20L1